Getting Rid of the Holidays Act I. Dairy Day. Word Metamorphism. The Nutty Professor. Voice Processing Module.
In support of the above concept, a study on the persons of Rasa -raktagata Sneha hyperlipidemia has been carried out assuming that the condition is an increased state of Snigdha Guna and treatment is done using Ruksa property drugs. Patients were divided into two groups, i.
The results were assessed after 45 days with the help of a specially prepared pro forma. All the important hematological, biochemical, and urine investigations were done. According to subjective and objective criteria, significant results were found for Group A as compared to Group B.
Application of the ReNuMa model in the Sha He river watershed: tools for watershed environmental management. Models and related analytical methods are critical tools for use in modern watershed management. A modeling approach for quantifying the source apportionment of dissolved nitrogen DN and associated tools for examining the sensitivity and uncertainty of the model estimates were assessed for the Sha He River SHR watershed in China. Hydrochemical processes of the SHR watershed, including streamflow, DN load fluxes, and corresponding DN concentration responses, were simulated following calibrations against observations of streamflow and DN fluxes.
Uncertainty analyses were conducted with a Monte Carlo analysis to vary model parameters for assessing the associated variations in model outputs. The model performed accurately at the watershed scale and provided estimates of monthly streamflows and nutrient loads as well as DN source apportionments. The simulations identified the dominant contribution of agricultural land use and significant monthly variations. These results provide valuable support for science-based watershed management decisions and indicate the utility of ReNuMa for such applications.
An herbal medicine, Go- sha -jinki-gan GJG, increases muscle weight in severe muscle dystrophy model mice. Full Text Available Go- sha -jinki-gan GJG, a traditional Japanese herbal medicine has a clinical implication to alleviate age-related symptoms, especially in some motor disorders. However, the scientific evidence is limited, and there is a possibility to expand the medical application range of GJG. Using senescence-accelerated mice, our group showed that GJG exerted an effect to prevent sarcopenia, the aged-related loss of skeletal muscle.
Because muscular dystrophy is characterized by a progressive loss of skeletal muscle, we examined the effects of GJG on a mouse model of muscular dystrophy. The increased skeletal muscle mass resulted from an increment in the myofiber size, but not from the myofiber number. Taken together, GJG increased the skeletal muscle mass in a mouse model of muscular dystrophy, in addition to our previously tested sarcopenia mouse model.
Jagtap, Chandrashekhar Y. Objectives: Herbo-mineral formulations are being successfully used in therapeutics since centuries. But recently, they came under the scanner for their metallic contents especially the presence of heavy metals. Hence it is the need of the hour to assess and establish the safety of these formulations through toxicity studies. In line with the various toxicity studies that are being carried out, Government of India expressed the need for conducting genotoxicity studies of different metal- or mineral-based drugs.
Till date very few Ayurvedic herbo-mineral formulations have been studied for their genotoxic potential. The present study is aimed to evaluate the genotoxic potential of Hridayarnava Rasa. Materials and Methods: It was prepared as per classical guidelines and administered to Swiss albino mice for 14 consecutive days.
Chromosomal aberration and sperm abnormality assay were done to evaluate the genotoxic potential of the test drugs. Cyclophosphamide CP was taken as positive group and results were compared. Results: All treated groups exhibited significant body weight gain in comparison to CP group. Results revealed no structural deformity in the above parameters in comparison to the CP-treated group.
Conclusion: Reported data showed that both tested samples of Hridayarnava Rasa does not possess genotoxic potential under the experimental conditions and can be safely used. The objective of this study was to assess the effect of SMD-2 on the levels of urinary copper Cu, zinc Zn, and selenium Se in lung cancer patients and head and neck cancer patients receiving chemoradiotherapy. Forty-two head and neck cancer patients and 10 lung cancer patients participated in our clinical trial.
Each patient received chemoradiotherapy for 4 weeks. In addition, each patient was treated with SMD-2 for 8 weeks, including 2 weeks prior to and after the chemoradiotherapy treatment. Comparison of urinary Cu, Zn, and Se levels and the ratios of Zn to Cu and Se to Cu at three time points in the two types of cancer were assessed using the generalized estimating equations GEEs.
After the patients received chemoradiotherapy for 4 weeks, SMD-2 treatment was found to be associated with a significant decrease in urinary Cu levels, whereas urinary Zn and Se levels increased significantly. In addition, the ratios of Zn to Cu and Se to Cu in the urine samples of these patients also increased significantly.
Both the urinary Zn levels and the ratio of Zn to Cu in head and neck cancer patients were significantly higher than in lung cancer patients. The SMD-2 treatments significantly increased Zn and Se levels in the urine of head and neck cancer patients. Increased Zn and Se levels in urine strengthened immune system.
Aplikasi teori belajar sosial dalam penatalaksanaan rasa takut dan cemasan anak pada perawatan gigi Application of social learning theory in the management of children dental fear and anxiety. Full Text Available Background: Dental anxiety is a prevalent problem faced by dentists till nowadays, especially in treating child patients. Several methods in managing anxiety are available, but there is no single method can be applied extensively.
Purpose: This article was aimed to describe the application of social learning theory in preventing or reducing dental anxiety in children. Literature review: Anxiety and fear are psych feelings that is experienced by a person. A child developed these feelings by learning from their own past experienced or by information obtained from their environment.
If fear and anxiety can be learned by a child, thus the opposite term which is preventing the feelings is assumed can be also offered to learned. This application actually being applied in the field of dentistry as modeling, but the exploration of how this process is due is often being ignored. Conclusion: Social learning theory provides an easy preventive approach and effective intervention that can be applied to children in years old to reduce dental anxiety.
Latar belakang: Kecemasan pada perawatan gigi merupakan hal yang paling sering dijumpai dan merupakan masalah yang dihadapi oleh dokter gigi sampai saat ini, terutama pada pasien anak. Berbagai metode penatalaksanaan kecemasan banyak tersedia, namun tidak satu pun metode yang dapat diterapkan secara luas. Tujuan: Makalah ini disusun untuk membahas mengenai aplikasi teori belajar sosial dalam mencegah kecemasan pada anak saat perawatan gigi.
Tinjauan pustaka: Rasa cemas dan takut merupakan perasaan psikis yang dialami seorang individu. Perasaan ini pada seorang anak lebih banyak didapat dari proses belajar dalam menyerap informasi berdasarkan pengalaman pribadi ataupun informasi dari lingkungan sekitar. Bila rasa cemas dan takut dapat dipelajari oleh seorang anak, maka diasumsikan bahwa menghindari timbulnya perasaan ini dapat pula diajarkan pada anak. Aplikasi hal tersebut sebenarnya telah diterapkan di bidang. The porous structure of the scaffold and cell attachment was observed by scanning electron microscopy SEM.
Biochemical measures of necrosis, cell proliferation, sulfated glycosaminoglycans sGAG content and extracellular matrix related gene expressions were quantitatively evaluated. The cell proliferation data showed good cellular viability in tricopolymer scaffold and increased optical density for total DNA demonstrated that the cells continued to proliferate inside the scaffold. The sGAG production indicated chondrogenic differentiation. Chondrocytes treated with betulin expressed transcripts encoding type II collagen, aggrecan, and decorin.
To conclude, the substantiated results supported cell proliferation, production of extracellular matrix proteins and down-regulation of matrix metalloproteases and cytokine, in betulin treated scaffolds. Excessive intake of aluminum chloride in drinking water is associated with amyloid plaques and neurofibrillary tangles in the brain, which are the hallmark of AD. We have evaluated brain energy metabolism in aluminum chloride AlCl3 mouse model of AD.
The memory of mice was measured using Morris Water Maze test. The 13C labeling of brain amino acids was measured ex vivo in tissue extracts using 1H-[13C]-NMR spectroscopy with timed infusion of [1,C2]glucose. The 13C turnover of brain amino acids was analyzed using a three-compartment metabolic model to derive the neurotransmitter cycling and TCA cycle rates associated with glutamatergic and GABAergic pathways.
Exposure of AlCl3 led to reduction in memory of mice. The glutamatergic and GABAergic neurotransmitter cycling and glucose oxidation were found to be reduced in the cerebral cortex, hippocampus, and striatum following chronic AlCl3 treatment. The perturbation in metabolic rates was highest in the cerebral cortex. However, reduction in metabolic fluxes was higher in hippocampus and striatum following one month post AlCl3 treatment. These data suggest therapeutic potential of RS to manage cognitive functions and memory in preclinical AD.
Preliminary analysis of the sandstone accumulation situation at Sha -3 of the Paleogene Series Shakhetsze in the Khekou basin of the Tsziyan region. The main productive level occurs in sandstone beds in the Sha -3 subseries reaching thickness of about m of the Shakhetsze series. The Bonan oil field was discovered in this region in The initially productive deposits were viewed as fluvial-delta; however, studies of recent years, including investigation of the sedimentation sequences and the structures that mark the surfaces of the microscopic level in the core sample, together with an analysis of borehole geophysical data, indicated that the sandy bodies of the productive beds in the basin must be viewed as deposits of turbidite flows and deposits of gravitational flows in channels.
Insofar as distribution of the turbidite sandstones differs significantly from the delta, this led to a review of the long-term trends in the neighboring fields. Berpikir dan Berperilaku dengan Rasa. Human as a complicated living creature has lot of feelings before making a reaction. In our daily life, we think a lot based on our feelings. We associate a stimulus with an unconscious physical or emotional response. A designer often needs to make a promotion, branding, and campaign for a product or something else.
So, it is important for designers to know their targets and behaviors. By understanding their target behaviors, it is easier to predict or to design the reaction and response when the product or campaign is launched. The understanding of the psychology study is important for a designer as well as understanding the other branch of study beside their own study about aesthetics.
When the designer understands a lot of things, they can make a creative, good and useful visual communication. Given that flight demand is forecast to reach 97 million passengers per year approx However, this presents many environmental constraints. Due to that the third runway will reclaim approximately hectares of the se so re-routing of speed boats and ferries has been planned. This includes one route that passes through the marine nursery inside the park.
This indirectly causes noise pollution that will affect marine life. Since dolphins rely on echolocation often discerned by a "click" sound to communicate and navigate, increasing marine traffic re-routing causes obscuring noises and acoustic communication interfering with echolocation, as well as collisions which lead to physical injuries.
Underwater construction works involving techniques such as percussive piling may interfere with the dolphins' echolocation capability. The data has been collected using a hydrophone by observing the noise frequency changes within the marine park. The noises come from a number of sources, including fishing boats, and speed boats, krill and around 20 estuarine fish species. The evaluation of four years has shown that noise pollution is increasing as indicated by the increase of frequencies around kHz and that it has caused disruption in regular dolphin movement irregular clicking sequence.
The forms tatsama or tadbhava, the meanings and the cultural connotations of these terms are herein thoroughly investigated. Full Text Available Enjoying the art exhibition is like enjoying a cup of hot sweet tea in the afternoon. There are mixed feelings that we enjoy when walking by the spaces and searching for the meaning of artworks.
A very special exhibition is associated with the day of years of the birth of a great leader of Ngayogyakarta Hadiningrat, Sultan HB IX. The exhibition was loaded with messages of journey of Yogyakarta and HB IX in the political role scene in the early period of independence until the present realities of Yogyakarta. Yogyakarta as the Kawah Candradimuka place to learn talented artists, reflected in the works of heavily loaded with the deepening of the concepts and ideas are very visionary and imaginary.
Sentuhan Rasa di Balik Makna Laba. Full Text Available This study aims to reveal the meaning of profit according to the existing customs, traditions and cultures of Aisyiyah hospitals. This qualitative study employed ethnographic approach which is realist in nature, and was geared to find out the meaning of profit through customs and rituals that had been practiced in the hospital for a long time. The research found that profit in the hospital is, first, interpreted from the abstract dimension, that is in the form sense.
Second, profit is a form of gratitude and happiness sense. Third, profit serves as a spreader of happiness. Generally, commercial MSG products did not specify the amount of a certain dose to produce palatable food. This problem could lead to uncontrolled and excessive use of MSG by consumers.
The aim of this study was to determine the values for the detection and preference threshold of umami taste from commercial MSG products at different salt level. The detection threshold was determined using R-index method in salt solutions. The preference threshold was determined by using hedonic rating in food model.
A food model selected in this case is spinach soup that is commonly consumed by Indonesian. The salt concentrations for detection and preference threshold experiment were 0. Detection threshold value using R-index method for 0. Different salt concentrations leads to differences in the values of threshold preferences and detection threshold of the umami taste of MSG. Increasing salt concentration tends to decrease the detection and preference threshold of umami taste from MSG.
This research results could be used as the basic information in food product formulation such as seasoning and condiment using mixtures of salt and MSG. Full Text Available The purpose of this study to analyze the factors affecting the intentions of alumni who are willing to assist their university, whether financial or non-financial.
The intentions of alumni are consequences of satisfaction and trust, where satisfaction and trust are the mediating variables of academic experience, current income, relation and agency image. The study was conducted through a survey method that included respondents living in Jakarta, with middle and upper class economic levels.
The sampling technique used is proportionate stratified random sampling. The finding from this study is the antecedent factors of satisfaction and trust including academic experience, income, relationships, and institution image that are proven to be positive and significantly influential in satisfaction and trust, partially or simultaneously. The behavior intention as a consequence of trust and satisfaction are found to be positive and significant although only moderate.
Therefore, for further research it is advisable to explore motivational factor, family education values and cultural factors as antecedents of behavior intention. Full Text Available. Full Text Available iqytlsdrdwksmlpsieaslralikigaieasipis gfkpgnqdtieqyikaiksngyksnqtvilsahqmgscrmgssksnsvvnengeswdvkr lfiadgsvl Full Text Available uence update Full Text Available pdate Full Text Available equence.
Fermented milk is milk processed product that to be one source of nutritious food for humans. The action of food component such as flavor is accepted, sense of taste and smell generated complex assessment of food flavors in the mouth. The flavor components of fermented milk together and interact with each other when consumed and cause the perception of taste between like or dislike.
This is an important factor in developing diversification of fermented milk product so as to attract customers other than in terms of aspects of nutrition and health. Flavor is one of the most important criteria in the acceptance of a food ingredient. During processing and storage flavor change easily. This study used gas chromatography to detect the formation of the active component of the flavor of fermented milk. The purpose of this study was to determine the active components in fermented milk which is the formation of flavor.
This study uses a Likens - Nickerson distillation stage concentrated with Vigreux column and identified by Gas Chromatography Mass Spectrometer. Gas chromatography has identified that the class of acids, alcohols, esters and alkanes group forming an active component in the flavor of fermented milk although relatively varied. In yoghurt, acid found in relatively high amount of alcohol is more varied in its kind.
Yogurt with single culture L. Volatile components were detected mostly in kefir acids, alcohols, esters and alkane derivatives. The curd is dominated by acidic components in addition to alcohol and aldehyde. Full Text Available Efforts to strengthen the character become the basis in the implementation of the curriculum Application of the curriculum provides a paradigm shift, which in the end result of learning students not only master the knowledge but also master the attitude and skills.
One of the two characters developed is curiosity and social care. To form the character, it needs an educational instrument such as a competent teacher, adequate learning resources, and the most important is the action of learning in the form of approach, model, method, or appropriate learning strategy.
So the application of discovery learning model with scientific approach. Which model is effective and efficient in bring up the character of curiosity and social care. Full Text Available The aim of this study was to evaluate the main motor and functional changes before and after physical therapy of a patient with spinal cord injury caused by diving in shallow water.
We analyzed previous records of a patient with spinal cord injury by diving in shallow water, who had rehabilitation at the Rehabilitation Clinical of Oeste Paulista, between and , attending two one-hour-sessions a week. The patient improved muscle strength as consequence of the rehabilitation program.
The treatment also helped the patient improve functionality observing the development while being transferred, in other words, during position changes, between and It is understood that patients with spinal cord injury show muscle strength and functional pattern improvement when undergoing physical therapy.
The results were evaluated for its contribution to improve nutrient content and to add more variation on fermentation product for consumer choice. The proportion of basic materials to salt and water were varied depending on the kind of fish and the optimum values were chosen. Fermented teri rucah needed addition of one part of salt and two parts of water, or one part of salt and one and half parts of water; fermented udang rucah needed addition of one part of salt and one part of water, or nine-tenth parts of sah and one-tenth parts of water, forevery three part of basic material.
All fermented products were analyzed for proximate nutrient contentand vitamin B content Fermented teri rucah was higher in protein and vitamin B content compared to that of udang rucah. In general liquefied fermentation increased vitamin B content by 2 to 4 times.
Incorporation of the produds into traditional cooking recipes need to be explored and socially marketed. Kultuurivarade halduse organiseerimisest. Kultuurivarade praktilisest haldamisest. Genealoogilisest materjalist. Quasi experimental were used in this study using pre test and post test design with control group.
Samples, 20 respondents in 2 groups were recruited using consecutive sampling. The intervention group received SEFT intervention combined with analgesic therapy and the control group given only analgesic therapy. SEFT intervention implemented after administrating analgesic, for minutes every day during five days. Pain was measured using numeric rating scale NRS. The combination SEFT intervention and analgesic therapy was more effective than only analgesic therapy.
SEFT can be employed for cancer patients to relieve their pain. This research is a classroom action research PTK , which consists of two cycles. The data collecting were using observation sheets, questionnaires and te Full Text Available This study aimed to understand the characteristics of the fear of failure based on a young entrepreneurial career interests of students.
This research is a qualitative research descriptive narrative with a phenomenological approach to the entrepreneurial young entrepreneur student member of the Indonesian Young Entrepreneurs Association at the Education University of Indonesia.
Results from this study is the fear of failure that is divided into three major themes of the careers of the consequences, consequences on the psychological and financial consequences to the student. Property booms and bubbles: a demolition strategy - towards a tabula rasa? There is a tendency to perversity in the effects of public policy for the built environment at large and with respect to specific sectors. This review paper addresses the unanticipated effects arising from the land and property development incentives which prevailed before the current economic.
The acquisition of biological knowledge during childhood: Cognitive conflict or tabula rasa? Clinical interviews were conducted with three elementary school children, who varied in age but not in family or school environment, to determine the extent to which they held naive misconceptions about important biological topics and to determine agewise trends in the development of biological knowledge. Does early biological knowledge acquisition follow a pattern of spontaneous naive theory construction and cognitive conflict or does it follow a pattern of gradual accretion to an initially blank slate?
Contrary to findings in the physical sciences, little evidence was found for biological misconceptions as knowledge acquisition appeared to more directly follow the gradual accretion hypothesis with the primary source of that knowledge adult authority rather than personal experience. However, conceptual change teaching is still advocated due to its ability to provoke students to consider and test alternative conceptions even if they are not their own as a means of encouraging the development of important general reasoning patterns utilized in the testing of causal hypotheses.
Samadai, Marsa Alam, Red Sea. The data were collected from October until. September using surface observations. Four objectives were studied: arrival and departure time of dolphins, distribution of dolphin movements within the Cai, Yutong; Zijlema, Wilma L. We investigated the effects of both ambient air pollution and traffic noise on adult asthma prevalence, using harmonised data from three European cohort studies established in HUNT3, Lifelines and UK Biobank.
Residential exposures to ambient air pollution particulate matter with. Multivariate logistic regression models were fitted to assess the effects of each exposure on lifetime and current asthma prevalence. Noise exposure was not significantly associated with asthma prevalence. This study suggests that long-term ambient PM 10 exposure is associated with asthma prevalence in western European adults.
Traffic noise is not associated with asthma prevalence, but its potential to impact on asthma exacerbations needs further investigation. Speeding up detection of SHA -1 collision attacks using unavoidable attack conditions.
That is, an algorithm that detects whether a given single message is part of a colliding message. The fatigue design of the mast arm structures and connections vary significantly based on the Category of Importance factor adopted and the load cases for fatigue design loads. Consideration should include the cost and size of the structures for both Eastern Thessaly region Central Greece shows numerous evidences of seismic activity ranging from structural, morphological, palaeoseismological, archaeological and historical.
In the present note, we focus on the latter two aspects. A fundamental source of historic data are the "Chronicles" of the monasteries of the area. Doubtless, the most important ones are those located in the Meteora region western Thessaly.
In the "Chronicles" of these monasteries few events are reported relative to the investigated region and particularly the August , occurred in the area of Larissa, the , the November 9, and the August 28, Maximum inferred intensity of the three latter earthquakes has been estimated of the VIII degree. Based on the tectonic setting of the possible seismogenic structures, these events are tentatively located in the Tyrnavos Basin, while no other events are known in this sector neither before the 16th century nor in more recent times, except the March earthquake occurred East of Larissa.
Archaeological information from the broader area concerns several sectors. According to the historian Rhianos 3rd century BC , the town was still there during the Classical Period 5th-4th century BC but according to Strabo it was disappeared at the end of the 1st century BC. As a consequence, frequent flooding events have continuously enriched the soil and probably enhanced the productivity of the area thus making it particularly appealing for farming.
The first excavations revealed that many blocks belonging to former buildings and stones with inscriptions were chaotically accumulated in hollows. On the other hand, the existence of this temple is documented during the third Macedonian War first half of the 2nd century BC without any doubt and consequently the destruction of the buildings must have occurred during this time window and they were rebuilt at some distance from its original location. The theatre was built at the beginning of the 3rd century BC during the Early Hellenistic times but following the traditional plan and architecture of the Classical time koilon, orchestra and scenic building.
During the 2nd century BC was added a Doric style proscenium in front of the scenic building. During the Imperial time last 10 years of the 1st century BC , the theatre underwent a deep re-handling due to a different use as arena.
In particular, a new and larger proscenium was built as a monumental decoration holding three frontispice with dedications of the Larissa people to the Emperor August, to Tiberius as "benefactor and founder". During the excavations of the theatre, several evidences of damages of the building have been observed. Probably the most important and more impressive damages are represented by the displacement of some of the blocks of the walls and the rupture of some of the blocks.
For example, some of the blocks show a typical concoid fracture clearly induced by a strong mechanical shock occurred in one of its corners. These rupture conditions are likely to be associated to the dynamic motion of the overlying block which acted as a hammer due to a strong acceleration. Numerous blocks are also dislocated and rotated. According to the size of the shifted blocks, their weight and the amount of displacement they suffered, we can tentatively estimate the peak acceleration occurred in the area and possibly the direction of the seismic waves.
The collected archaeological and historical data, have been also compared with the available palaeoseismological data, while possible inferences for the seismic hazard of the region will be discussed. Over the past two decades, wind induced fatigue cracking of highway signs, luminaires, and traffic signal support structures have been increasingly reported all over the United States.
While fatalities associated with these failures have been limited As a member of the Chickasaw, the author pondered what he would find in the museum that would represent the Chickasaw Nation. Would the museum reflect his people in all their diversity? Would he see something of…. We present a new concept of biclique as a tool for preimage attacks, which employs many powerful techniques from differential cryptanalysis of block ciphers and hash functions.
The new tool has proved to be widely applicable by inspiring many authors to publish new results of the full versions Full Text Available Rock al Parque Varios autores. Buying decision made by customer based on their beliefs is the right decision. There is a brand equity, if thecustomers have the brand awareness, perceived quality, brand association and brandloyalty.
Full Text Available The purpose of the study is to produce the tourism geography module based on the Lombok tourism packages that is prepared in accordance with the module design of C Michael and Stephen J. Based on the results of validation and field trials, the numbers of scores are obtained namely: a the assessment of the expert design towards the components of the module is The average value of the results of validation and field trials, the module is developed and appropriately used as learning sources with percentage Michael Hall dan Stephen J.
Kualitas produk diketahui melalui hasil tanggapan dari dosen pengampu matakuliah dan mahasiswa pada saat uji lapangan. Investigation of antihyperglycaemic activity of banana Musa sp. Nanjangud rasa bale pseudostem in normal and diabetic rats. Different parts of banana have been in use in conventional medicinal formulations since ancient times. Its role as an antihyperglycaemic agent has also been studied.
This study was aimed at explaining the mechanism of hypoglycaemic effect by ethanol extract of banana pseudostem EE. Additionally, studies on the active components involved in the effect have also been attempted. Hence the results extend a foundation to the future prospects of the food-derived enzyme inhibitors in treatment of diabetes.
Identification has been made of synthetic dyes contained in the powder drink orange flavor in Chromatography Paper at the Center for Food and Drug Administration. From the results of the analysis obtained dye Sunset Yellow and Tart Effects of morpho dynamics in shallow waters over pipeline facilities; Efeitos da morfodinamica em aguas rasas sobre instalacoes de dutos.
Toldo Junior, Elirio E. The success in developing of the oil industry operating in offshore-onshore terminals, connected by pipelines with the facilities of the coastal zone, can be attributed partially to the beach morpho dynamic monitoring. This study represents a solution to the concerns of the technical operations in coastal zones because it minimizes the impact of the petroleum production and it assures the environmental protection associated to the risks of the pipelines breaking.
This impact type results mainly of the vertical and horizontal displacements of the beach, from the coastal dunes to the shore face. The mobility of the profile is associated to the magnitude of the sedimentary processes, which reproduce naturally or not, in scale of time that can vary among few days, years or decades.
For the monitoring and interpretation of the beach profile mobility the following methods are recommended: calculation of the closure depth with base in the wave data; bathymetric survey with sled; calculation of the equilibrium beach profile, and monitoring of the variations of the shoreline using satellite images, GPS or aerial photography. This study aims to provide security solutions for implementing electronic medical records EMRs. Majority of the required security features of EMRs were noted.
The methods used were tested against each of these security features. In implementing the system, the combination that satisfied all of the security features of EMRs was selected. Secure implementation and management of EMRs facilitate the safeguarding of the confidentiality, integrity, and availability of e-health organization systems. Health practitioners, patients, and visitors can use the information system facilities safely and with confidence anytime and anywhere.
After critically reviewing security and data transmission methods, a new hybrid method was proposed to be implemented on EMR systems. This method will enhance the robustness, security, and integration of EMR systems. Noise and vibration reduction technology in hybrid vehicle development; Hybrid sha kaihatsu ni okeru shindo soon teigen gijutsu.
Accomplishing both environmental protection and good NVH performance has become a significant task in automotive development The first-in-the-world hybrid passenger car of mass production. It also mentions application technology of low rolling resistance tires with light weight wheels and recycled material for sound proofing. Supply of carbon fiber for a natural gas car tank; Tennen gasu sha tanku muke tanso seni no kyokyu.
Mitsubishi Rayon shared investment with the Dynatech Company in Canada to produce carbon fiber tanks used in natural gas cars, and attempted to monopolize the supply of carbon fibers for tanks. As for the natural gas automobile with low air pollution and exhaust of carbon oxide compared to gasoline automobile, a heavy CNG tank is the bottleneck of its popularization, and its weight could be reduced to one fourth of a steel tank by using carbon fibers.
In Japan, only steel tank has been licensed until now. Selling will be increasing in Japan by the co-operation with the Dynatech Company since this carbon fiber can be used from this April. International students bring racial attitudes and group preferences that affect campus climates.
Thirty-five out of…. Dewasa ini keberadaan sektor pariwisata, terutama dibidang perhotelan telah banyak menyumbangkan devisa bagi negara. Hal ini terlihat semakin pesatnya persaingan bisnis dibidang ini perhotelan. Dengan seiring berjalannya waktu, kini hotel semakin meningkatkan kualitas dan produk serta jasa dari pelayanannya.
Banyak atau sedikitnya jumlah kunjungan tamu dapat dilihat dari baik buruknya pelayanan hotel tersebut. Dengan memperhatikan seluruh area hotel dan meningkatkan hygiene dan sanitasi p Banana is an extensively cultivated plant worldwide, mainly for its fruit, while its ancillary product, the banana flower is consumed as a vegetable and is highly recommended for diabetics in the traditional Indian medicine system.
This study is based on an investigation of the in vivo antihyperglycaemic activity of Umbelliferone C1 and Lupeol C2 isolated from the ethanol extract of banana flower EF in alloxan induced diabetic rat model. HbA1c extent was reduced whereas levels of insulin and Hb were increased. Both the extract and compounds wielded positive impacts in diabetic rats by reversal of altered activities of hepatic marker enzymes viz. Besides these, the treatment increased the activities of enzymatic and non-enzymatic antioxidants in the serum and liver.
Full Text Available Banana is an extensively cultivated plant worldwide, mainly for its fruit, while its ancillary product, the banana flower is consumed as a vegetable and is highly recommended for diabetics in the traditional Indian medicine system.
Evaluation of waste concrete road materials for use in oyster aquaculture : [research summary]. The SHA also intends to increase the use of : recycled materials and to use products South Africa is one of the most 'unequal' societies in the world. Adolescence is a unique time-point during which intervention may lead to improved mental health and reduced social problems later. The study objective was to assess mental health disparities in a representative sample of adolescents growing up in South Africa.
Self-ascribed ethnicity was determined using procedures similar to the South African census and previous national surveys. Respondents self-identifying as 'black' or 'coloured' were disadvantaged across most indicators. After adjusting for confounders, relative to white children, relative risk RR of CMD in black children was 2.
Putative mediators violence, racially motivated bullying, social support, self-esteem partially accounted for differences in CMD and fully for PTSD. Adolescent mental health inequalities in Cape Town are associated with material disadvantage and self-identification with historically disadvantaged groups. Presentation of electric motor and motor control technology for electric vehicles and hybrid vehicles; Denki jidosha hybrid sha yo motor oyobi motor seigyo gijutsu no shokai.
The authors have developed a motor drive system for electric vehicles and hybrid vehicles. This system consists of a permanent magnet type synchronous motor, an inverter using insulated gate bipolar transistors IGBTs and a controller based on a single-chip microcomputer. To achieve a compact and light weight synchronous motor, an internal permanent magnet type rotor structure was designed.
This paper presents motor control technology for electric vehicles, such as an optimization method of field weakening control and a new current control method. Fa-fa-fa-fa, de doo doo doo, de da da da, sha la la la lee : What is the optimal syllable in improvised singing?
The aim of this paper is to describe and account for the optimal syllable structure in improvised singing without lyrics. Improvised singing has an overall relaxed character and it is abstracted from meaning. Furthermore, singing in general involves an exaggerated articulation of speech sounds. Among them are 1 incorporating multi-target scenarios into the MITM framework, leading to faster preimages from pseudo-preimages, 2 a simple precomputation technique that allows for finding new Fall is a common cause of disability and death in old adults, and much research has been focused on identifying risk factors and developing preventive measures.
Yet the majority of preceding research has been focused on physical performance. This study aims to evaluate the association between fall and depressive symptoms in community-dwelling elderly. Cross-sectional data of men and women was collected from old Korean adults living in Seongnam, Korea. Geriatric fall assessment was conducted by self-report questionnaires. Results indicated that depressive symptoms were associated with both fall and fear of falling in old adults.
A clear gender difference was newly discovered, as depression played a stronger role in women. These results imply that clinicians should consider the negative affect of geriatric patients when assessing fall risk. Also, measures against depression might be effective in reducing falls. Full Text Available South Africa is one of the most 'unequal' societies in the world. Qanun raqam 68 li-sanat fi sha 'n al-ta'lim al-am Law No.
This document is an English-language abstract approximately 1, words of a law passed by the UAR legislation covering elementary, preparatory, and secondary education. This law covers general regulations common to all three stages of education, the objectives of which are defined as the general intellectual, physical, moral, civic and national….
The security of the widely-used cryptographic hash function SHA 1 has been impugned. We have developed two replacement hash functions. Mineralogical and chemical characterization of iron-, manganese-, and copper-containing synthetic hydroxyapatites.
The substitution of metals into SHA suggests that metal- SHA materials are potential slow-release sources of micronutrients for plant uptake in addition to Ca and P. The study of shallow impurities in semiconductor heterostructures, such as quantum and superlattices, has been of continuous interest over the last years.
Successful comparisons between experimental results photoluminescence: N. N Ledentsov et al. A 54, and theoretical calculations [L. Oliveira and G. Mahan, Phys. B 47, ] constitute a strong motivation for an in-depth theoretical study. We present a variational calculation of the binding energies of shallow donors in a Ga-As-AlGaAs quantum well.
The density of impurity states, intra-donor transition strengths and the infrared absorption spectra are calculated for some of these excited states and results compared with previous theoretical [S. Fraizzoli, F. Bassani, and R. Buczko, Phys. B 41, ] and experimental works [N.
Jarosik et al. The assumption of perfect supports fixed or pinned foundations for the boundary conditions of reinforced concrete buildings has been used for many years by structural engineers. This fact is mainly attributed to the great difficulties faced in the past, when designers needed to calculate buildings by using manual methods.
Nowadays, realistic analysis that takes into account the deformability of the adjacent soil foundation is possible,based on the development of powerful computers and computational software packages. However, many structural engineers still use the same simplified boundary conditions widely used in the past. The main explanation for this problem may be the lack of information and models available in the literature, as well as the lack of interaction between structural engineers and foundation engineers.
In this context, the present paper aims to present practical recommendations for applying the soil-structure interaction. Additionally, based on some practical examples, this paper shows that the rigid support hypothesis may lead reinforced concrete columns to significant force distortions.
Full Text Available The expansion of Darwinism stimulated a great deal of interest about the phenomena associated with heredity during the years. Spanish anarchists, even though they were not specifically interested in the causes of variation and heredity, manifested an explicit concern about its potential effects.
In fact, the analogy between memory and heredity, normally linked with Neolamarckian theories, proved to be extremely useful to rationalise those aspects of social and historical reality more difficult to accept from a libertarian point of view. Full Text Available This research used duck eggs age one as subject day. There were two factors analyzed here. The first was the amount of palm sugar which consisted of 25 grams, 50 grams, and 75 grams.
The second factor were the storage duration which consisted of 3, 4, and 5 weeks. The nutrient content parameters measured were rates protein, fat and ash content. Sensory quality parameters measured were color and taste. However, organoleptic test showed that palm sugar addition did not influenced color and taste of salted duck egg significantly.
Energy conservation and modernization plan for Chhatak Cement Co. Chhatak Cement sha shoene, kindaika keikaku. With an objective of saving energies and reducing greenhouse gas emission, discussions were given on a modernization plan for the Chhatak cement factory in The People's Republic of Bangladesh.
The Chhatak cement factory having a nominal production capability of , tons a year uses mainly wet-type long kilns of old type, consuming a great amount of natural gas. The present plan has discussed adoption of the Japanese energy saving technologies. The technologies use a vertical roller mill for raw material pulverization, a suspension preheater and a short kiln for clinker sintering, a grate cooler for clinker cooling, and the pre-crushing system.
This will mean the annual reduction of about 22, tons as converted to crude oil. The CO2 reduction amount would reach 51, tons a year. The result of the financial analysis according to the case studies appears severe, wherein reduction of the various expenses is desired possibly by the finance from Japan with generous conditions. Dai 28 kai sekitan kagaku kaigi dai 91 kai cokes tokubetsukai.
As to coal science, studies are mainly on the brown coal two-stage liquefaction BCL method, and data on the pilot plant and PSU are reported. Concerning bituminous coal liquefaction, PSU data mostly including the NEDOL process, and characteristics of liquefaction residue and its effective utilization by thermal decomposition are reported.
Regarding the liquefaction mechanism, an experimentally extensive study on catalyst, solvent and reaction conditions is made using model materials and coal itself on the bench scale and also in the pilot plant. Engineering subjects on residue, solvent deashing, scale attachment and coprocessing are also reported. Relations of decomposition process to coal chemical structure changes and reaction conditions are investigated.
As to coal gasification, studies, which are not many, are conducted on material balance, heat balance, and image characteristics of char for gasification and factors controlling reactivity. Fiscal research report. Basic research on joint implementations promotion Feasibility study of modification for Tehran Cement Co. The feasibility study was started upon a request made by the Iranian Ministry of Energy involving the No.
It was then concluded, after assessing the degree of urgency of supply and demand and the magnitude of loss due to reduced production because of the on-site modification work, that it was not practical to begin the project immediately. Under the circumstances, various studies were made about the feasibility of modification of the whole production process of the No.
The procedure will consist of Phase I wherein the No. Under this procedure, the modernization of the Tehran Cement Co. After the completion of the project, an annual yield of 3. Application of CDM clean development mechanism to this project will be extremely effective in reducing greenhouse gas and in improving profitability.
This project is aimed at energy-saving diagnosis of 30 energy-intensive manufacturing plants in Thailand, to draw the project plans and clarify, e. The 30 plants analyzed are 6 metal-related plants, 3 non-ferrous plants, 5 chemical plants, 6 ceramics plant, 4 textile plants, 4 food processing plants and 2 pulp plants.
Two or more feasible energy-saving measures are studied for each plant. A total of improvement measures approximately 6 on the average for each plant are identified as the ones related to energy-saving and operation controlling techniques. The measures of high cost-effectiveness are use of an appropriate pressure for air compressors and resting of transformers on non-working days.
Sustainable practices and related performances at state highway agencies. This report identifies seven ways in which an SHA can harm the environment: 1 excessive consumption of virgin materials; 2 unnecessary levels or amounts of storm water runoff; 3 release of environmental contaminants by SHA employees and conract The products were characterized by x-ray diffraction, field emission scanning electron microscopy, thermogravimetric analysis, mechanical testing and biomimetic mineralization. Penerimaan panelis menunjukkan bahwa perlakuan tepung ikan gabus berpengaruh nyata p0,05 terhadap aroma, rasa , warna dan keseluruhan biskuit.
Kata kunci: Biskuit fungsional, subtitusi, fortifikasi. Callithamniella flexilis Baardseth, Cryptonemia seminervis C. Agardh J. Agardh, Cladophora pseudorupestris C. Hoek e Cladophora cf. Greater knowledge of the macroalgae from rocky shores is essential to monitor and manage marine coastal conservation units. The present study aimed to improve the taxonomic survey of seaweeds from the Picinguaba unit and to evaluate the suitability of sampling methodology for rocky shore communities in this conservation unit.
Thirteen sampling stations, situated between Almada and Cambury Headlands, were studied in summer ; this part of the PESM coastal zone is subject to anthropogenic interference. We carefully searched for macroalgae in different rocky habitats, from the sublittoral fringe towards the sand domain. Aiming to standardize sampling effort at each station, the same specialist searched for macroalgae over a 20 m horizontal extension of the rocky shore, for one hour, by apnea diving.
Hoek and Cladophora cf. These species are described and illustrated here. Sixty four species are new occurrences for the rocky shores of PESM. In conclusion, for monitoring purposes of the Picinguaba coastal environment, we recommend sampling rocky shore macroalgae yearly, in the summer, using the methodology described in this paper.
Dementia-specific quality of life instruments and their appropriateness in shared-housing arrangements--a literature study. Shared-housing arrangements SHA in Germany are a specific type of housing arrangement that belongs to the global concept of small-scale living arrangements. This caring approach comprises characteristics of both home and institutional care for persons with dementia. To evaluate the impact of SHA on the quality of life QoL of residents, an appropriate setting- and dementia-specific QoL instrument is needed.
After a comprehensive literature review, existing dementia-specific QoL instruments were evaluated to determine whether any have been specifically designed for or applied in SHA. Additionally, each domain of the instruments was matched with the core domains of SHA.
None of the existing instruments was identified as having been developed for SHA. For the first time, a basis has been created for valid QoL evaluations of residents with dementia living in SHA. The 4 identified instruments are considered applicable in SHA. Conducting a performance test and evaluating further attributes according to the Scientific Advisory Committee of the Medical Outcomes Trust e.
Fiscal report on basic research for promotion of joint implementation programs. Heat and power plant reconstruction project for Yuzhmash Company co-generating plant, Donepropetrovsk City, the Ukraine; nendo Donepropetrovsk shi Yuzhmansh sha Heat and Power Plant Reconstruction Project chosa hokokusho. Duis ac turpis. Hence we could say that bitcoin binary options are binary options traded in Bitcoins or that in which you can fund and withdraw your money in bitcoins Bitcoin Binary Options are financial instruments that allow you to predict if the price of Bitcoin will rise or fall in a bitcoin option binary specific amount of time.
Open to all US residents. Play Instructions Account. Prime Option Trade allows you to actively trade most popular cryptocurrencies such as Bitcoin, Ethereum, Ripple, Litecoin and more, profit from market rallies and declines, or hedge your existing cryptocurrency holdings Nadex will offer daily and weekly bitcoin binary options contracts, taking prices from the bitcoin price index published by TeraExchange, a derivatives trading platform.
If you think it will be, then you buy The binary options trading platform on offer by OptionBit is not. Binary options trading can bring substantial income in the shortest time possible. Bitcoin options. As most Binary Options traders can tell you, there are a number of factors that impact on the price of a binary option Trading on Binary Options bitcoin option binary and Bitcoin has never been easier.
Stockbrokers are seeing the value in trading BTC …. Total earned by our traders in You can use your Bitcoins for binary options trading in two different ways. Buy a binary option, it can be a Call option or Put option and for the right prediction, you can make a profit.
The income of our traders. Available Options. With no bank as a bitcoin option binary middleman in exchange, things become more complicated; so hackers and con men have had a heyday Binary Options is a financial instrument used to make profit by predicting an asset's price movement currencies, shares, commodities. Binary options in cryptocurrency. Donec sit amet eros. Sed laoreet aliquam leo.
Binary bitcoin option binary options in cryptocurrency.
Ubijalar biasanya diolah menjadi tepung untuk industri pangan. Ubikayu , jika dibiarkan pada batang tanamannnya dan tetap berada dalam tanah , dapat bertahan berbulan-bulan dengan mutu yang tetap baik. Setelah itu akan terjadi penurunan mutu yang cukup cepat sehingga nilainya akan banyak berkurang baik untuk konsumsi langsung maupun untuk aplikasi industri.
Ubikayu dapat dipanen kapan saja sepanjang tahun. Banyak petani yang memanennya setelah enam bulan ditanam , sementara yangyang lainnya mungkin memanennya seteah sembilan bahkan setelah 12 bulan. Mutu ubikayu , dalam hal kandungan patinya , meningkat seiring dengan umur panen , dan mencapai kondisi optimum setelah sembilan hingga 12 bulan tergantung jenisnya. Ubikayu biasanya dipanen secara manual dengan tangan , atau menggunakan alat bantu pengungkit. Panen akan lebih mudah dan cepat dilakukan bila tanahnya berpasir , atau tanah yang gembur , atau ketika baru saja diguyur hujan.
Pada tanah yang keras , atau pada musim kemarau , panen ubikayu biasanya memerlukan penggalian di sekitar pangkal batang hingga kedalaman umbi , kemudian umbi diangkat bersama batangnya. Untuk memudahkan pengangkatan , biasanya batang tanaman dipotong dan disisakan antara 30 hingga 50 cm untuk pegangan. Pengangkatan harus dilakukan dengan hati-hati untuk menghindari patahnya umbi dan tertinggal di dalam tanah. Selain kemungkinan hilang jika tidak diambil kemudian, umbi yang patah juga akan mempercepat proses pembusukan karena kontaminasi mikroba.
Penanganan Ubikayu. Di berbagai negara, berbagai metoda penanganan dan pengolahan ubikayu dilakukan, bukan hanya untuk meningkatkan umur simpan dan kegunaannya, tapi juga untuk meningkatkan keamanannya karena ubikayu berpotensi mengandung asam sianida yang dapat menimbulkan keracunan bahkan kematian. Beberapa metoda penanganan dan pengolahan akan iuraikan di bawah, yang merupakan kombinasi dari pengolahan primer dan sekunder.
Namun demikian, pengupasan juga membuang enzim linamarin, yang berguna untuk netralisasi racun dalam proses pengolahan, dalam jumlah besar yang terdapat pada kulit. Misalnya, pemarutan ubikayu dengan kulitnya seperti yang dilakukan di Brazil dlam pembuatan farinha, dapat menghilangkan potensi asam sianida dalam pengolahan selanjutnya. Pengupasan biasanya dilakukan secara manual menggunakan pisau.
Alat pengupas mekanis telah dibuat dengan desain yang sederhana sehingga dapat diproduksi oleh bengkel kecil dengan performa yang cukup baik dan susut yang minimum , namun pada umumnya pengupas mekanis tingkat efisiensinya rendah. Untuk beberapa tahun ke depan, pengupasan manual masih merupakan pilihan utama. Gambar 1. Alat pengupas ubikayu. Ubikayu seringkali dikonsumsi sebagai sumber karboidrat setelah direbus sekitar 15 hingga 30 menit. Beberapa varietas memberikan hasil umbi yang empuk , kenyal , dan mudah perebusannya.
Di beberapa negara di Afrika , setelah direbus ubikayu kadangkala ditumbuk menjadi pasta yang lembut yang disebut fufu. Varietas yang lain menghasilkan umbi yang keras dan lengket , juga agak berkayu setelah direbus , yang tidak dapat diolah menjadi fufu. Pengecilan ukuran perajangan dan pemarutan.
Ukuran ubikayu kadangkala terlalu besar untuk diolah langsung sehingga perlu dikecilkan ukurannya sebelum diolah. Dalam pembuatan gaplek atau tepung ubikayu , di tingkat rumah tangga , ubikayu dirajang secara manual menggunakan pisau. Pekerjaan berlangsung lambat dan menghasilkan irisan yang tidak seragam , memerlukan 3 sampai 7 hari penjemuran untuk pengeringannya sehingga menimbukan bau asam.
Perajangan manual mempunyai kelebihan dalam menghasilkan rajangan yang ebih tipis dan seragam sehingga dapat dikeringkan dengan lebih cepat melalui penjemuran. Irisan ubikayu berbentuk jari tangan lebih menguntungkan dalam penjemuran , karena irisan yang tipis cenderung menempel satu sama lain sehingga harus selalu diurai dalam penjemuran , bila tidak hasil pengeringan tidak seragam.
Irisan ubikayu sebesar jari kelingking dapat dikeringkan melalui penjemuran selama 6 sampai 8 jam. Area tropis seperti negara kita ini cukup mudah ditumbuhi berbagai jenis umbi-umbian, selain singkong dan ubi ada umbi lain seperti talas atau gembili. Hal ini yang membuat kita menjadi sering mengolah berbagai jenis umbi-umbian karena memang produksinya cukup baik di negara kita. Umbi-umbian umumnya dikenal sebagai golongan makanan yang dapat dijadikan bahan makanan pokok.
Berbagai jenis umbi mulai dilirik sebagai bahan makanan pengganti nasi dan mulai banyak diolah menjadi tepung terigu atau olahan lain. Biasanya kita tetap sering mengonsumsi dengan mengolahnya secara sederhana unutk konsumsi sendiri misalnya dengan merebus atau menggoreng. Namun ternyata ada jenis umbi yang apabila kita keliru dalam mengolahnya malah jadi berbahaya.
Salah satu jenis umbi tersebut adalah talas. Talas merupakan salah satu umbi yang sering dipakai sebagai bahan baku untuk olahan makanan lain, sebut saja keripik, dodol atau tepung terigu. Tapi kita perlu memahami persiapan sebelum mengolah talas harus dilakukan dengan tepat, hal ini karena talas memiliki kandungan kalium oksalat yang dapat menyebabkan gangguan berupa iritasi dan gatal-gatal pada kulit.
When the designer understands a lot of things, they can make a creative, good and useful visual communication. Given that flight demand is forecast to reach 97 million passengers per year approx However, this presents many environmental constraints. Due to that the third runway will reclaim approximately hectares of the se so re-routing of speed boats and ferries has been planned. This includes one route that passes through the marine nursery inside the park.
This indirectly causes noise pollution that will affect marine life. Since dolphins rely on echolocation often discerned by a "click" sound to communicate and navigate, increasing marine traffic re-routing causes obscuring noises and acoustic communication interfering with echolocation, as well as collisions which lead to physical injuries.
Underwater construction works involving techniques such as percussive piling may interfere with the dolphins' echolocation capability. The data has been collected using a hydrophone by observing the noise frequency changes within the marine park. The noises come from a number of sources, including fishing boats, and speed boats, krill and around 20 estuarine fish species.
The evaluation of four years has shown that noise pollution is increasing as indicated by the increase of frequencies around kHz and that it has caused disruption in regular dolphin movement irregular clicking sequence.
The forms tatsama or tadbhava, the meanings and the cultural connotations of these terms are herein thoroughly investigated. Full Text Available Enjoying the art exhibition is like enjoying a cup of hot sweet tea in the afternoon. There are mixed feelings that we enjoy when walking by the spaces and searching for the meaning of artworks. A very special exhibition is associated with the day of years of the birth of a great leader of Ngayogyakarta Hadiningrat, Sultan HB IX.
The exhibition was loaded with messages of journey of Yogyakarta and HB IX in the political role scene in the early period of independence until the present realities of Yogyakarta. Yogyakarta as the Kawah Candradimuka place to learn talented artists, reflected in the works of heavily loaded with the deepening of the concepts and ideas are very visionary and imaginary. Sentuhan Rasa di Balik Makna Laba.
Full Text Available This study aims to reveal the meaning of profit according to the existing customs, traditions and cultures of Aisyiyah hospitals. This qualitative study employed ethnographic approach which is realist in nature, and was geared to find out the meaning of profit through customs and rituals that had been practiced in the hospital for a long time. The research found that profit in the hospital is, first, interpreted from the abstract dimension, that is in the form sense.
Second, profit is a form of gratitude and happiness sense. Third, profit serves as a spreader of happiness. Generally, commercial MSG products did not specify the amount of a certain dose to produce palatable food. This problem could lead to uncontrolled and excessive use of MSG by consumers. The aim of this study was to determine the values for the detection and preference threshold of umami taste from commercial MSG products at different salt level.
The detection threshold was determined using R-index method in salt solutions. The preference threshold was determined by using hedonic rating in food model. A food model selected in this case is spinach soup that is commonly consumed by Indonesian. The salt concentrations for detection and preference threshold experiment were 0.
Detection threshold value using R-index method for 0. Different salt concentrations leads to differences in the values of threshold preferences and detection threshold of the umami taste of MSG. Increasing salt concentration tends to decrease the detection and preference threshold of umami taste from MSG. This research results could be used as the basic information in food product formulation such as seasoning and condiment using mixtures of salt and MSG.
Full Text Available The purpose of this study to analyze the factors affecting the intentions of alumni who are willing to assist their university, whether financial or non-financial. The intentions of alumni are consequences of satisfaction and trust, where satisfaction and trust are the mediating variables of academic experience, current income, relation and agency image.
The study was conducted through a survey method that included respondents living in Jakarta, with middle and upper class economic levels. The sampling technique used is proportionate stratified random sampling. The finding from this study is the antecedent factors of satisfaction and trust including academic experience, income, relationships, and institution image that are proven to be positive and significantly influential in satisfaction and trust, partially or simultaneously.
The behavior intention as a consequence of trust and satisfaction are found to be positive and significant although only moderate. Therefore, for further research it is advisable to explore motivational factor, family education values and cultural factors as antecedents of behavior intention.
Full Text Available. Full Text Available iqytlsdrdwksmlpsieaslralikigaieasipis gfkpgnqdtieqyikaiksngyksnqtvilsahqmgscrmgssksnsvvnengeswdvkr lfiadgsvl Full Text Available uence update Full Text Available pdate Full Text Available equence. Fermented milk is milk processed product that to be one source of nutritious food for humans.
The action of food component such as flavor is accepted, sense of taste and smell generated complex assessment of food flavors in the mouth. The flavor components of fermented milk together and interact with each other when consumed and cause the perception of taste between like or dislike.
This is an important factor in developing diversification of fermented milk product so as to attract customers other than in terms of aspects of nutrition and health. Flavor is one of the most important criteria in the acceptance of a food ingredient.
During processing and storage flavor change easily. This study used gas chromatography to detect the formation of the active component of the flavor of fermented milk. The purpose of this study was to determine the active components in fermented milk which is the formation of flavor. This study uses a Likens - Nickerson distillation stage concentrated with Vigreux column and identified by Gas Chromatography Mass Spectrometer.
Gas chromatography has identified that the class of acids, alcohols, esters and alkanes group forming an active component in the flavor of fermented milk although relatively varied. In yoghurt, acid found in relatively high amount of alcohol is more varied in its kind. Yogurt with single culture L. Volatile components were detected mostly in kefir acids, alcohols, esters and alkane derivatives. The curd is dominated by acidic components in addition to alcohol and aldehyde. Full Text Available Efforts to strengthen the character become the basis in the implementation of the curriculum Application of the curriculum provides a paradigm shift, which in the end result of learning students not only master the knowledge but also master the attitude and skills.
One of the two characters developed is curiosity and social care. To form the character, it needs an educational instrument such as a competent teacher, adequate learning resources, and the most important is the action of learning in the form of approach, model, method, or appropriate learning strategy.
So the application of discovery learning model with scientific approach. Which model is effective and efficient in bring up the character of curiosity and social care. Full Text Available The aim of this study was to evaluate the main motor and functional changes before and after physical therapy of a patient with spinal cord injury caused by diving in shallow water.
We analyzed previous records of a patient with spinal cord injury by diving in shallow water, who had rehabilitation at the Rehabilitation Clinical of Oeste Paulista, between and , attending two one-hour-sessions a week. The patient improved muscle strength as consequence of the rehabilitation program. The treatment also helped the patient improve functionality observing the development while being transferred, in other words, during position changes, between and It is understood that patients with spinal cord injury show muscle strength and functional pattern improvement when undergoing physical therapy.
The results were evaluated for its contribution to improve nutrient content and to add more variation on fermentation product for consumer choice. The proportion of basic materials to salt and water were varied depending on the kind of fish and the optimum values were chosen. Fermented teri rucah needed addition of one part of salt and two parts of water, or one part of salt and one and half parts of water; fermented udang rucah needed addition of one part of salt and one part of water, or nine-tenth parts of sah and one-tenth parts of water, forevery three part of basic material.
All fermented products were analyzed for proximate nutrient contentand vitamin B content Fermented teri rucah was higher in protein and vitamin B content compared to that of udang rucah. In general liquefied fermentation increased vitamin B content by 2 to 4 times. Incorporation of the produds into traditional cooking recipes need to be explored and socially marketed. Kultuurivarade halduse organiseerimisest.
Kultuurivarade praktilisest haldamisest. Genealoogilisest materjalist. Quasi experimental were used in this study using pre test and post test design with control group. Samples, 20 respondents in 2 groups were recruited using consecutive sampling. The intervention group received SEFT intervention combined with analgesic therapy and the control group given only analgesic therapy.
SEFT intervention implemented after administrating analgesic, for minutes every day during five days. Pain was measured using numeric rating scale NRS. The combination SEFT intervention and analgesic therapy was more effective than only analgesic therapy. SEFT can be employed for cancer patients to relieve their pain. This research is a classroom action research PTK , which consists of two cycles.
The data collecting were using observation sheets, questionnaires and te Full Text Available This study aimed to understand the characteristics of the fear of failure based on a young entrepreneurial career interests of students. This research is a qualitative research descriptive narrative with a phenomenological approach to the entrepreneurial young entrepreneur student member of the Indonesian Young Entrepreneurs Association at the Education University of Indonesia. Results from this study is the fear of failure that is divided into three major themes of the careers of the consequences, consequences on the psychological and financial consequences to the student.
Property booms and bubbles: a demolition strategy - towards a tabula rasa? There is a tendency to perversity in the effects of public policy for the built environment at large and with respect to specific sectors. This review paper addresses the unanticipated effects arising from the land and property development incentives which prevailed before the current economic. The acquisition of biological knowledge during childhood: Cognitive conflict or tabula rasa? Clinical interviews were conducted with three elementary school children, who varied in age but not in family or school environment, to determine the extent to which they held naive misconceptions about important biological topics and to determine agewise trends in the development of biological knowledge.
Does early biological knowledge acquisition follow a pattern of spontaneous naive theory construction and cognitive conflict or does it follow a pattern of gradual accretion to an initially blank slate? Contrary to findings in the physical sciences, little evidence was found for biological misconceptions as knowledge acquisition appeared to more directly follow the gradual accretion hypothesis with the primary source of that knowledge adult authority rather than personal experience.
However, conceptual change teaching is still advocated due to its ability to provoke students to consider and test alternative conceptions even if they are not their own as a means of encouraging the development of important general reasoning patterns utilized in the testing of causal hypotheses.
Samadai, Marsa Alam, Red Sea. The data were collected from October until. September using surface observations. Four objectives were studied: arrival and departure time of dolphins, distribution of dolphin movements within the Cai, Yutong; Zijlema, Wilma L. We investigated the effects of both ambient air pollution and traffic noise on adult asthma prevalence, using harmonised data from three European cohort studies established in HUNT3, Lifelines and UK Biobank.
Residential exposures to ambient air pollution particulate matter with. Multivariate logistic regression models were fitted to assess the effects of each exposure on lifetime and current asthma prevalence. Noise exposure was not significantly associated with asthma prevalence. This study suggests that long-term ambient PM 10 exposure is associated with asthma prevalence in western European adults. Traffic noise is not associated with asthma prevalence, but its potential to impact on asthma exacerbations needs further investigation.
Speeding up detection of SHA -1 collision attacks using unavoidable attack conditions. That is, an algorithm that detects whether a given single message is part of a colliding message. The fatigue design of the mast arm structures and connections vary significantly based on the Category of Importance factor adopted and the load cases for fatigue design loads. Consideration should include the cost and size of the structures for both Eastern Thessaly region Central Greece shows numerous evidences of seismic activity ranging from structural, morphological, palaeoseismological, archaeological and historical.
In the present note, we focus on the latter two aspects. A fundamental source of historic data are the "Chronicles" of the monasteries of the area. Doubtless, the most important ones are those located in the Meteora region western Thessaly. In the "Chronicles" of these monasteries few events are reported relative to the investigated region and particularly the August , occurred in the area of Larissa, the , the November 9, and the August 28, Maximum inferred intensity of the three latter earthquakes has been estimated of the VIII degree.
Based on the tectonic setting of the possible seismogenic structures, these events are tentatively located in the Tyrnavos Basin, while no other events are known in this sector neither before the 16th century nor in more recent times, except the March earthquake occurred East of Larissa.
Archaeological information from the broader area concerns several sectors. According to the historian Rhianos 3rd century BC , the town was still there during the Classical Period 5th-4th century BC but according to Strabo it was disappeared at the end of the 1st century BC.
As a consequence, frequent flooding events have continuously enriched the soil and probably enhanced the productivity of the area thus making it particularly appealing for farming. The first excavations revealed that many blocks belonging to former buildings and stones with inscriptions were chaotically accumulated in hollows.
On the other hand, the existence of this temple is documented during the third Macedonian War first half of the 2nd century BC without any doubt and consequently the destruction of the buildings must have occurred during this time window and they were rebuilt at some distance from its original location.
The theatre was built at the beginning of the 3rd century BC during the Early Hellenistic times but following the traditional plan and architecture of the Classical time koilon, orchestra and scenic building. During the 2nd century BC was added a Doric style proscenium in front of the scenic building.
During the Imperial time last 10 years of the 1st century BC , the theatre underwent a deep re-handling due to a different use as arena. In particular, a new and larger proscenium was built as a monumental decoration holding three frontispice with dedications of the Larissa people to the Emperor August, to Tiberius as "benefactor and founder". During the excavations of the theatre, several evidences of damages of the building have been observed.
Probably the most important and more impressive damages are represented by the displacement of some of the blocks of the walls and the rupture of some of the blocks. For example, some of the blocks show a typical concoid fracture clearly induced by a strong mechanical shock occurred in one of its corners. These rupture conditions are likely to be associated to the dynamic motion of the overlying block which acted as a hammer due to a strong acceleration.
Numerous blocks are also dislocated and rotated. According to the size of the shifted blocks, their weight and the amount of displacement they suffered, we can tentatively estimate the peak acceleration occurred in the area and possibly the direction of the seismic waves.
The collected archaeological and historical data, have been also compared with the available palaeoseismological data, while possible inferences for the seismic hazard of the region will be discussed. Over the past two decades, wind induced fatigue cracking of highway signs, luminaires, and traffic signal support structures have been increasingly reported all over the United States.
While fatalities associated with these failures have been limited As a member of the Chickasaw, the author pondered what he would find in the museum that would represent the Chickasaw Nation. Would the museum reflect his people in all their diversity? Would he see something of….
We present a new concept of biclique as a tool for preimage attacks, which employs many powerful techniques from differential cryptanalysis of block ciphers and hash functions. The new tool has proved to be widely applicable by inspiring many authors to publish new results of the full versions Full Text Available Rock al Parque Varios autores. Buying decision made by customer based on their beliefs is the right decision.
There is a brand equity, if thecustomers have the brand awareness, perceived quality, brand association and brandloyalty. Full Text Available The purpose of the study is to produce the tourism geography module based on the Lombok tourism packages that is prepared in accordance with the module design of C Michael and Stephen J.
Based on the results of validation and field trials, the numbers of scores are obtained namely: a the assessment of the expert design towards the components of the module is The average value of the results of validation and field trials, the module is developed and appropriately used as learning sources with percentage Michael Hall dan Stephen J.
Kualitas produk diketahui melalui hasil tanggapan dari dosen pengampu matakuliah dan mahasiswa pada saat uji lapangan. Investigation of antihyperglycaemic activity of banana Musa sp. Nanjangud rasa bale pseudostem in normal and diabetic rats. Different parts of banana have been in use in conventional medicinal formulations since ancient times.
Its role as an antihyperglycaemic agent has also been studied. This study was aimed at explaining the mechanism of hypoglycaemic effect by ethanol extract of banana pseudostem EE. Additionally, studies on the active components involved in the effect have also been attempted. Hence the results extend a foundation to the future prospects of the food-derived enzyme inhibitors in treatment of diabetes.
Identification has been made of synthetic dyes contained in the powder drink orange flavor in Chromatography Paper at the Center for Food and Drug Administration. From the results of the analysis obtained dye Sunset Yellow and Tart Effects of morpho dynamics in shallow waters over pipeline facilities; Efeitos da morfodinamica em aguas rasas sobre instalacoes de dutos. Toldo Junior, Elirio E. The success in developing of the oil industry operating in offshore-onshore terminals, connected by pipelines with the facilities of the coastal zone, can be attributed partially to the beach morpho dynamic monitoring.
This study represents a solution to the concerns of the technical operations in coastal zones because it minimizes the impact of the petroleum production and it assures the environmental protection associated to the risks of the pipelines breaking. This impact type results mainly of the vertical and horizontal displacements of the beach, from the coastal dunes to the shore face.
The mobility of the profile is associated to the magnitude of the sedimentary processes, which reproduce naturally or not, in scale of time that can vary among few days, years or decades. For the monitoring and interpretation of the beach profile mobility the following methods are recommended: calculation of the closure depth with base in the wave data; bathymetric survey with sled; calculation of the equilibrium beach profile, and monitoring of the variations of the shoreline using satellite images, GPS or aerial photography.
This study aims to provide security solutions for implementing electronic medical records EMRs. Majority of the required security features of EMRs were noted. The methods used were tested against each of these security features.
In implementing the system, the combination that satisfied all of the security features of EMRs was selected. Secure implementation and management of EMRs facilitate the safeguarding of the confidentiality, integrity, and availability of e-health organization systems. Health practitioners, patients, and visitors can use the information system facilities safely and with confidence anytime and anywhere.
After critically reviewing security and data transmission methods, a new hybrid method was proposed to be implemented on EMR systems. This method will enhance the robustness, security, and integration of EMR systems. Noise and vibration reduction technology in hybrid vehicle development; Hybrid sha kaihatsu ni okeru shindo soon teigen gijutsu.
Accomplishing both environmental protection and good NVH performance has become a significant task in automotive development The first-in-the-world hybrid passenger car of mass production. It also mentions application technology of low rolling resistance tires with light weight wheels and recycled material for sound proofing.
Supply of carbon fiber for a natural gas car tank; Tennen gasu sha tanku muke tanso seni no kyokyu. Mitsubishi Rayon shared investment with the Dynatech Company in Canada to produce carbon fiber tanks used in natural gas cars, and attempted to monopolize the supply of carbon fibers for tanks.
As for the natural gas automobile with low air pollution and exhaust of carbon oxide compared to gasoline automobile, a heavy CNG tank is the bottleneck of its popularization, and its weight could be reduced to one fourth of a steel tank by using carbon fibers. In Japan, only steel tank has been licensed until now. Selling will be increasing in Japan by the co-operation with the Dynatech Company since this carbon fiber can be used from this April.
International students bring racial attitudes and group preferences that affect campus climates. Thirty-five out of…. Dewasa ini keberadaan sektor pariwisata, terutama dibidang perhotelan telah banyak menyumbangkan devisa bagi negara.
Hal ini terlihat semakin pesatnya persaingan bisnis dibidang ini perhotelan. Dengan seiring berjalannya waktu, kini hotel semakin meningkatkan kualitas dan produk serta jasa dari pelayanannya. Banyak atau sedikitnya jumlah kunjungan tamu dapat dilihat dari baik buruknya pelayanan hotel tersebut. Dengan memperhatikan seluruh area hotel dan meningkatkan hygiene dan sanitasi p Banana is an extensively cultivated plant worldwide, mainly for its fruit, while its ancillary product, the banana flower is consumed as a vegetable and is highly recommended for diabetics in the traditional Indian medicine system.
This study is based on an investigation of the in vivo antihyperglycaemic activity of Umbelliferone C1 and Lupeol C2 isolated from the ethanol extract of banana flower EF in alloxan induced diabetic rat model. HbA1c extent was reduced whereas levels of insulin and Hb were increased. Both the extract and compounds wielded positive impacts in diabetic rats by reversal of altered activities of hepatic marker enzymes viz.
Besides these, the treatment increased the activities of enzymatic and non-enzymatic antioxidants in the serum and liver. Full Text Available Banana is an extensively cultivated plant worldwide, mainly for its fruit, while its ancillary product, the banana flower is consumed as a vegetable and is highly recommended for diabetics in the traditional Indian medicine system. Evaluation of waste concrete road materials for use in oyster aquaculture : [research summary].
The SHA also intends to increase the use of : recycled materials and to use products South Africa is one of the most 'unequal' societies in the world. Adolescence is a unique time-point during which intervention may lead to improved mental health and reduced social problems later. The study objective was to assess mental health disparities in a representative sample of adolescents growing up in South Africa.
Self-ascribed ethnicity was determined using procedures similar to the South African census and previous national surveys. Respondents self-identifying as 'black' or 'coloured' were disadvantaged across most indicators. After adjusting for confounders, relative to white children, relative risk RR of CMD in black children was 2. Putative mediators violence, racially motivated bullying, social support, self-esteem partially accounted for differences in CMD and fully for PTSD.
Adolescent mental health inequalities in Cape Town are associated with material disadvantage and self-identification with historically disadvantaged groups. Presentation of electric motor and motor control technology for electric vehicles and hybrid vehicles; Denki jidosha hybrid sha yo motor oyobi motor seigyo gijutsu no shokai. The authors have developed a motor drive system for electric vehicles and hybrid vehicles. This system consists of a permanent magnet type synchronous motor, an inverter using insulated gate bipolar transistors IGBTs and a controller based on a single-chip microcomputer.
To achieve a compact and light weight synchronous motor, an internal permanent magnet type rotor structure was designed. This paper presents motor control technology for electric vehicles, such as an optimization method of field weakening control and a new current control method. Fa-fa-fa-fa, de doo doo doo, de da da da, sha la la la lee : What is the optimal syllable in improvised singing?
The aim of this paper is to describe and account for the optimal syllable structure in improvised singing without lyrics. Improvised singing has an overall relaxed character and it is abstracted from meaning. Furthermore, singing in general involves an exaggerated articulation of speech sounds. Among them are 1 incorporating multi-target scenarios into the MITM framework, leading to faster preimages from pseudo-preimages, 2 a simple precomputation technique that allows for finding new Fall is a common cause of disability and death in old adults, and much research has been focused on identifying risk factors and developing preventive measures.
Yet the majority of preceding research has been focused on physical performance. This study aims to evaluate the association between fall and depressive symptoms in community-dwelling elderly. Cross-sectional data of men and women was collected from old Korean adults living in Seongnam, Korea.
Geriatric fall assessment was conducted by self-report questionnaires. Results indicated that depressive symptoms were associated with both fall and fear of falling in old adults. A clear gender difference was newly discovered, as depression played a stronger role in women.
These results imply that clinicians should consider the negative affect of geriatric patients when assessing fall risk. Also, measures against depression might be effective in reducing falls. Full Text Available South Africa is one of the most 'unequal' societies in the world.
Qanun raqam 68 li-sanat fi sha 'n al-ta'lim al-am Law No. This document is an English-language abstract approximately 1, words of a law passed by the UAR legislation covering elementary, preparatory, and secondary education. This law covers general regulations common to all three stages of education, the objectives of which are defined as the general intellectual, physical, moral, civic and national….
The security of the widely-used cryptographic hash function SHA 1 has been impugned. We have developed two replacement hash functions. Mineralogical and chemical characterization of iron-, manganese-, and copper-containing synthetic hydroxyapatites. The substitution of metals into SHA suggests that metal- SHA materials are potential slow-release sources of micronutrients for plant uptake in addition to Ca and P. The study of shallow impurities in semiconductor heterostructures, such as quantum and superlattices, has been of continuous interest over the last years.
Successful comparisons between experimental results photoluminescence: N. N Ledentsov et al. A 54, and theoretical calculations [L. Oliveira and G. Mahan, Phys. B 47, ] constitute a strong motivation for an in-depth theoretical study. We present a variational calculation of the binding energies of shallow donors in a Ga-As-AlGaAs quantum well.
The density of impurity states, intra-donor transition strengths and the infrared absorption spectra are calculated for some of these excited states and results compared with previous theoretical [S. Fraizzoli, F. Bassani, and R. Buczko, Phys. B 41, ] and experimental works [N. Jarosik et al. The assumption of perfect supports fixed or pinned foundations for the boundary conditions of reinforced concrete buildings has been used for many years by structural engineers.
This fact is mainly attributed to the great difficulties faced in the past, when designers needed to calculate buildings by using manual methods. Nowadays, realistic analysis that takes into account the deformability of the adjacent soil foundation is possible,based on the development of powerful computers and computational software packages. However, many structural engineers still use the same simplified boundary conditions widely used in the past.
The main explanation for this problem may be the lack of information and models available in the literature, as well as the lack of interaction between structural engineers and foundation engineers. In this context, the present paper aims to present practical recommendations for applying the soil-structure interaction. Additionally, based on some practical examples, this paper shows that the rigid support hypothesis may lead reinforced concrete columns to significant force distortions.
Full Text Available The expansion of Darwinism stimulated a great deal of interest about the phenomena associated with heredity during the years. Spanish anarchists, even though they were not specifically interested in the causes of variation and heredity, manifested an explicit concern about its potential effects. In fact, the analogy between memory and heredity, normally linked with Neolamarckian theories, proved to be extremely useful to rationalise those aspects of social and historical reality more difficult to accept from a libertarian point of view.
Full Text Available This research used duck eggs age one as subject day. There were two factors analyzed here. The first was the amount of palm sugar which consisted of 25 grams, 50 grams, and 75 grams. The second factor were the storage duration which consisted of 3, 4, and 5 weeks. The nutrient content parameters measured were rates protein, fat and ash content. Sensory quality parameters measured were color and taste.
However, organoleptic test showed that palm sugar addition did not influenced color and taste of salted duck egg significantly. Energy conservation and modernization plan for Chhatak Cement Co. Chhatak Cement sha shoene, kindaika keikaku. With an objective of saving energies and reducing greenhouse gas emission, discussions were given on a modernization plan for the Chhatak cement factory in The People's Republic of Bangladesh. The Chhatak cement factory having a nominal production capability of , tons a year uses mainly wet-type long kilns of old type, consuming a great amount of natural gas.
The present plan has discussed adoption of the Japanese energy saving technologies. The technologies use a vertical roller mill for raw material pulverization, a suspension preheater and a short kiln for clinker sintering, a grate cooler for clinker cooling, and the pre-crushing system. This will mean the annual reduction of about 22, tons as converted to crude oil. The CO2 reduction amount would reach 51, tons a year. The result of the financial analysis according to the case studies appears severe, wherein reduction of the various expenses is desired possibly by the finance from Japan with generous conditions.
Dai 28 kai sekitan kagaku kaigi dai 91 kai cokes tokubetsukai. As to coal science, studies are mainly on the brown coal two-stage liquefaction BCL method, and data on the pilot plant and PSU are reported. Concerning bituminous coal liquefaction, PSU data mostly including the NEDOL process, and characteristics of liquefaction residue and its effective utilization by thermal decomposition are reported.
Regarding the liquefaction mechanism, an experimentally extensive study on catalyst, solvent and reaction conditions is made using model materials and coal itself on the bench scale and also in the pilot plant. Engineering subjects on residue, solvent deashing, scale attachment and coprocessing are also reported. Relations of decomposition process to coal chemical structure changes and reaction conditions are investigated.
As to coal gasification, studies, which are not many, are conducted on material balance, heat balance, and image characteristics of char for gasification and factors controlling reactivity. Fiscal research report. Basic research on joint implementations promotion Feasibility study of modification for Tehran Cement Co. The feasibility study was started upon a request made by the Iranian Ministry of Energy involving the No.
It was then concluded, after assessing the degree of urgency of supply and demand and the magnitude of loss due to reduced production because of the on-site modification work, that it was not practical to begin the project immediately. Under the circumstances, various studies were made about the feasibility of modification of the whole production process of the No.
The procedure will consist of Phase I wherein the No. Under this procedure, the modernization of the Tehran Cement Co. After the completion of the project, an annual yield of 3. Application of CDM clean development mechanism to this project will be extremely effective in reducing greenhouse gas and in improving profitability. This project is aimed at energy-saving diagnosis of 30 energy-intensive manufacturing plants in Thailand, to draw the project plans and clarify, e.
The 30 plants analyzed are 6 metal-related plants, 3 non-ferrous plants, 5 chemical plants, 6 ceramics plant, 4 textile plants, 4 food processing plants and 2 pulp plants. Two or more feasible energy-saving measures are studied for each plant. A total of improvement measures approximately 6 on the average for each plant are identified as the ones related to energy-saving and operation controlling techniques.
The measures of high cost-effectiveness are use of an appropriate pressure for air compressors and resting of transformers on non-working days. Sustainable practices and related performances at state highway agencies. This report identifies seven ways in which an SHA can harm the environment: 1 excessive consumption of virgin materials; 2 unnecessary levels or amounts of storm water runoff; 3 release of environmental contaminants by SHA employees and conract The products were characterized by x-ray diffraction, field emission scanning electron microscopy, thermogravimetric analysis, mechanical testing and biomimetic mineralization.
Penerimaan panelis menunjukkan bahwa perlakuan tepung ikan gabus berpengaruh nyata p0,05 terhadap aroma, rasa , warna dan keseluruhan biskuit. Kata kunci: Biskuit fungsional, subtitusi, fortifikasi. Callithamniella flexilis Baardseth, Cryptonemia seminervis C. Agardh J. Agardh, Cladophora pseudorupestris C.
Hoek e Cladophora cf. Greater knowledge of the macroalgae from rocky shores is essential to monitor and manage marine coastal conservation units. The present study aimed to improve the taxonomic survey of seaweeds from the Picinguaba unit and to evaluate the suitability of sampling methodology for rocky shore communities in this conservation unit.
Thirteen sampling stations, situated between Almada and Cambury Headlands, were studied in summer ; this part of the PESM coastal zone is subject to anthropogenic interference. We carefully searched for macroalgae in different rocky habitats, from the sublittoral fringe towards the sand domain. Aiming to standardize sampling effort at each station, the same specialist searched for macroalgae over a 20 m horizontal extension of the rocky shore, for one hour, by apnea diving.
Hoek and Cladophora cf. These species are described and illustrated here. Sixty four species are new occurrences for the rocky shores of PESM. In conclusion, for monitoring purposes of the Picinguaba coastal environment, we recommend sampling rocky shore macroalgae yearly, in the summer, using the methodology described in this paper.
Dementia-specific quality of life instruments and their appropriateness in shared-housing arrangements--a literature study. Shared-housing arrangements SHA in Germany are a specific type of housing arrangement that belongs to the global concept of small-scale living arrangements. This caring approach comprises characteristics of both home and institutional care for persons with dementia.
To evaluate the impact of SHA on the quality of life QoL of residents, an appropriate setting- and dementia-specific QoL instrument is needed. After a comprehensive literature review, existing dementia-specific QoL instruments were evaluated to determine whether any have been specifically designed for or applied in SHA. Additionally, each domain of the instruments was matched with the core domains of SHA. None of the existing instruments was identified as having been developed for SHA. For the first time, a basis has been created for valid QoL evaluations of residents with dementia living in SHA.
The 4 identified instruments are considered applicable in SHA. Conducting a performance test and evaluating further attributes according to the Scientific Advisory Committee of the Medical Outcomes Trust e. Fiscal report on basic research for promotion of joint implementation programs. Heat and power plant reconstruction project for Yuzhmash Company co-generating plant, Donepropetrovsk City, the Ukraine; nendo Donepropetrovsk shi Yuzhmansh sha Heat and Power Plant Reconstruction Project chosa hokokusho.
To be newly installed are three gas turbine power generators rating: 26MW, main fuel: natural gas , three waste heat recovery boilers additionally fired boilers, 2-pressure natural circulation type , and one 40MW water circulation type mixed pressure steam turbine power generator including a bleeder for co-generation. Profitability is assessed using EIRR economic internal rate of return when the exchange rate is set at 4. Basic investigation on promotion of joint implementation in fiscal Energy saving projects at two steel making companies in Fushun City in China; nendo kyodo jisshi nado suishin kiso chosa hokokusho.
Chugoku Fushun shi ni okeru tekko gaisha 2 sha no shoene project chosa hokokusho. With an objective of saving energy and reducing greenhouse gas emission, investigations and discussions were given on two steel making companies in China. Discussions were given for Fushun Special Steel Co. As a result of the discussions, it was revealed that the unit requirement for electric power used at Fushun Special Steel can be reduced largely, and so can the fuel used at Fushun New Steel. The annual energy saving effect would be about million yen relative to the investment amount of 2.
The greenhouse gas emission would be reduced annually by 40, t-CO2 and 60, t-CO2 respectively. Fushun Special Steel will execute an international bid in May this year. Consideration on the dynamics of course-driver-vehicle system of four-wheel steering vehicles. Static directional stability and approximation of general motion by chain of steady-state circular turns; 4WS sha no shinro-driver-jidoshakei no undo rikigaku ni kansuru ichikosatsu.
Seiteki hoko anteisei oyobi teijoen senkai de tsunagu kinjisei no kento. Some numerical calculations have shown the tendency similar to the actual steering now used by a Japanese manufacturer. This idea would be useful in the automatic driving systems such as ITS. He writes his book in Kefe and dedicates it to II. Gazi Giray.
He constitutes his book, Razname, by omutting some of the stories and adding some new one. In this paper it is explained how to get a healty critical text of Razname. Seniors' experiences of living in special housing accommodation. This article presents a hermeneutic phenomenological analysis of interview material in which 12 seniors living in Special Housing Accommodation SHA facilities reflect on the experience of living in such facilities.
Of particular interest in the analysis is living in a SHA as a phenomenon. The finding shows that the phenomenon of lived experience in a SHA seems to be a state of ambiguity regarding one's existence, which is made up of several constituents elements of meaning.
The analysis contributes to the understanding of how the phenomenon of SHA living is coming into existence as a need, due to an individual's failing health; however, the SHA is not considered to be a true home. Accordingly, this has consequences to the subject position for the seniors in that they have to navigate between existing and not existing. The seniors learn to cope with living in the SHA by lowering their expectations of life and existence while the SHA provides the prerequisites for their existence.
An implication for promoting care is to support the seniors to enable a full existence of life within SHA living. Research Articles Sadhana Indian Academy of Sciences. Home; Journals; Sadhana. O P Sha. Articles written in Sadhana. Volume 31 Issue 5 October pp Design of fair surfaces over irregular domains is a Due to the quick advancements in the personal communications systems and wireless communications, giving data security has turned into a more essential subject.
This security idea turns into a more confounded subject when next-generation system requirements and constant calculation speed are considered in real-time. Hash functions are among the most essential cryptographic primitives and utilized as a part of the many fields of signature authentication and communication integrity.
These functions are utilized to acquire a settled size unique fingerprint or hash value of an arbitrary length of message. Since the logical operation of the hash types of SHA -1, SHA , SHA and SHA -3 are bits, so a Superscalar Hash Microprocessor without Interlocked Pipelines MIPS processor are designed with only few instructions that were required in invoking the desired Hash algorithms, when the four types of hash algorithms executed sequentially using the designed processor, the total time required equal to approximately us, with a throughput of 4.
Collage sur BACH. Cantus in Memoriam Benjamin Britten. Festina Lente. Tabula rasa. New Releases. AbstrakPendidikan adalah aset masa depan untuk mewujudkan generasi penerus yang berkualitas. Kualitas itu harus didukung dengan penghargaan diri yang baik. Kebanyakan remaja saat ini, hanya memiliki kemampuan akademis tanpa rasa aktif atau penghargaan diri yang tinggi.
Hal ini menjadi tugas bagi orang tua untuk dapat menumbuhkan rasa penghargaan diri itu, melalui interaksi yang baik dalam keluarga. Penelitian ini adalah penelitian kuantitatif dengan cluster random sampling. Penelitian ini ber Salicylhydroxamic acid is a salicylate derivative. Radiolabeling of Salicyl hydroxamic acid SHA with iodine may have considerable interest for imaging of urinary bladder.
This study is aimed to optimize the radiolabeling yield of Salicyl hydroxamic with radio iodine using chloramine - T CAT as an oxidizing agent with respect to factors that affect the reaction conditions such as SHA amount, CAT amount, reaction time and ph of the reaction mixture. In - vitro stability of the radiolabeled complex was checked and it was found to be stable for up to 24 h.
Bio - distribution studies have revealed that I- SHA was excreted in urine with extent that it could give a clear image for urinary bladder especially if the bladder it tightly closed. The amount of I - Salicyl hydroxamic excreted was increased in case of giving potassium bicarbonate to rat before injection of I- SHA. Radiological survey activities: uranium mill tailings remedial action project procedures manual.
The US Department of Energy DOE was assigned the responsibility for conducting remedial action at 24 sites, which are located in one eastern and nine western states. Using choice architecture to exploit a university Distinct Urban Mine. There are widespread concerns regarding the potential future scarcity of ferrous and non-ferrous materials. However, there are already potentially rich reserves of secondary materials via high ownership of Electrical and Electronic Equipment EEE in economically-developed nations.
Young people are particularly high consumers of EEE, thus university students and campuses may present an opportunity to harness this potential. University Distinct Urban Mines DUM may be used to exemplify how potential reserves of secondary metals may be exploited, and could contribute to the transition from a linear to a circular economy.
To this purpose, a quantitative survey was undertaken to measure students' ownership and discarding behaviour with respect to SHA. The amounts of ferrous and non-ferrous materials were then estimated and converted to monetary values from secondary materials market data to appraise the SHA DUM overall value. Thirty-five per cent of SHA are discarded in the general refuse. Broken personal care appliances PCA tend to be discarded due to hygiene and small size factors. When in working order, SHA tend to be equally reused, recycled or stockpiled.
We conclude that a total of tonnes of ferrous and non-ferrous materials were available via discarding or being stockpiled at the University of Southampton. To initiate DUM exploitation within Higher Education campuses, we suggest improving users' choice architecture by providing collection methods specific to broken SHA.
Spatial and temporal variation of Peridinium umbonatum F. The highest biovolume 7. L-1 of this alga occurred near shore at the beginning of the rainy season, in November Smaller values of P. Both, the temporal and spatial scales were relevant in the presence of P. The plant community structure, mainly submersed macrophytes, has affected the P. Os menores valores de biovolume P.
Small circuits for cryptography. Here we show circuit designs for AES and SHA -1 that have an extremely small hardware footprint, yet show reasonably good performance characteristics as compared to the state of the art designs found in the literature. Our AES performance numbers are fueled by an optimized composite field S-box design for the Stratix chipset.
Servidor d'escriptoris remots. Aquest entorn permet usar i adaptar, segons es Subtask 5. Suiso yuso chozo gijutsu no kaihatsu daisanpen ekitai suiso chozo setsubi no kaihatsu Air Liquide sha seika hokoku. Among those, the basic concepts were summarized which are necessary for the design of a liquid hydrogen tanker in terms of safety, and the extraporation of the existing low temperature technology into the large liquid hydrogen tank was studied.
When considering safety at fire, for keeping safety of the same level as that of the LNG tanker, it is not appropriate to adopt the conventional vacuum insulation liquid hydrogen tank. In the fiscal study, 7 kinds of concept of the insulation structure were assumed, and it was concluded that BOR of 0.
Bitcoin options. As most Binary Options traders can tell you, there are a number of factors that impact on the price of a binary option Trading on Binary Options bitcoin option binary and Bitcoin has never been easier.
Stockbrokers are seeing the value in trading BTC …. Total earned by our traders in You can use your Bitcoins for binary options trading in two different ways. Buy a binary option, it can be a Call option or Put option and for the right prediction, you can make a profit.
The income of our traders. Available Options. With no bank as a bitcoin option binary middleman in exchange, things become more complicated; so hackers and con men have had a heyday Binary Options is a financial instrument used to make profit by predicting an asset's price movement currencies, shares, commodities. Binary options in cryptocurrency. Donec sit amet eros. Sed laoreet aliquam leo. Binary bitcoin option binary options in cryptocurrency.
If you are correct you receive a financial payoff. To open an account with Binary. The ability to trade binary options for Bitcoin is even newer, with new, fully featured exchanges benefiting from the speed, anonymity and no transaction costs which come with using BTC. The company keeps the clients funds in banks with AAA rates and ensures you with the complete safety on all the deposits, no.
The review will give you a deeper understanding of how they operate. There are essentially two things that are called Bitcoin binary options trading which are as follows: — Trading on the future movement in the value of Bitcoins — Using Bitcoins as a currency to trade regular options There is a huge difference between these two things as you will find out in this article Bitcoin Binary Options Brokers — Legal Brokers That Accept Bitcoin Financial trade and investments was considered to be a tough career choice according to most people.
All ….
Hydrochemical processes of the SHR watershed, including streamflow, DN load fluxes, and corresponding DN concentration responses, were simulated following calibrations against observations of streamflow and DN fluxes. Uncertainty analyses were conducted with a Monte Carlo analysis to vary model parameters for assessing the associated variations in model outputs.
The model performed accurately at the watershed scale and provided estimates of monthly streamflows and nutrient loads as well as DN source apportionments. The simulations identified the dominant contribution of agricultural land use and significant monthly variations.
These results provide valuable support for science-based watershed management decisions and indicate the utility of ReNuMa for such applications. An herbal medicine, Go- sha -jinki-gan GJG, increases muscle weight in severe muscle dystrophy model mice. Full Text Available Go- sha -jinki-gan GJG, a traditional Japanese herbal medicine has a clinical implication to alleviate age-related symptoms, especially in some motor disorders. However, the scientific evidence is limited, and there is a possibility to expand the medical application range of GJG.
Using senescence-accelerated mice, our group showed that GJG exerted an effect to prevent sarcopenia, the aged-related loss of skeletal muscle. Because muscular dystrophy is characterized by a progressive loss of skeletal muscle, we examined the effects of GJG on a mouse model of muscular dystrophy. The increased skeletal muscle mass resulted from an increment in the myofiber size, but not from the myofiber number.
Taken together, GJG increased the skeletal muscle mass in a mouse model of muscular dystrophy, in addition to our previously tested sarcopenia mouse model. Jagtap, Chandrashekhar Y. Objectives: Herbo-mineral formulations are being successfully used in therapeutics since centuries. But recently, they came under the scanner for their metallic contents especially the presence of heavy metals. Hence it is the need of the hour to assess and establish the safety of these formulations through toxicity studies.
In line with the various toxicity studies that are being carried out, Government of India expressed the need for conducting genotoxicity studies of different metal- or mineral-based drugs. Till date very few Ayurvedic herbo-mineral formulations have been studied for their genotoxic potential. The present study is aimed to evaluate the genotoxic potential of Hridayarnava Rasa.
Materials and Methods: It was prepared as per classical guidelines and administered to Swiss albino mice for 14 consecutive days. Chromosomal aberration and sperm abnormality assay were done to evaluate the genotoxic potential of the test drugs. Cyclophosphamide CP was taken as positive group and results were compared. Results: All treated groups exhibited significant body weight gain in comparison to CP group.
Results revealed no structural deformity in the above parameters in comparison to the CP-treated group. Conclusion: Reported data showed that both tested samples of Hridayarnava Rasa does not possess genotoxic potential under the experimental conditions and can be safely used. The objective of this study was to assess the effect of SMD-2 on the levels of urinary copper Cu, zinc Zn, and selenium Se in lung cancer patients and head and neck cancer patients receiving chemoradiotherapy.
Forty-two head and neck cancer patients and 10 lung cancer patients participated in our clinical trial. Each patient received chemoradiotherapy for 4 weeks. In addition, each patient was treated with SMD-2 for 8 weeks, including 2 weeks prior to and after the chemoradiotherapy treatment.
Comparison of urinary Cu, Zn, and Se levels and the ratios of Zn to Cu and Se to Cu at three time points in the two types of cancer were assessed using the generalized estimating equations GEEs. After the patients received chemoradiotherapy for 4 weeks, SMD-2 treatment was found to be associated with a significant decrease in urinary Cu levels, whereas urinary Zn and Se levels increased significantly. In addition, the ratios of Zn to Cu and Se to Cu in the urine samples of these patients also increased significantly.
Both the urinary Zn levels and the ratio of Zn to Cu in head and neck cancer patients were significantly higher than in lung cancer patients. The SMD-2 treatments significantly increased Zn and Se levels in the urine of head and neck cancer patients. Increased Zn and Se levels in urine strengthened immune system. Aplikasi teori belajar sosial dalam penatalaksanaan rasa takut dan cemasan anak pada perawatan gigi Application of social learning theory in the management of children dental fear and anxiety.
Full Text Available Background: Dental anxiety is a prevalent problem faced by dentists till nowadays, especially in treating child patients. Several methods in managing anxiety are available, but there is no single method can be applied extensively. Purpose: This article was aimed to describe the application of social learning theory in preventing or reducing dental anxiety in children. Literature review: Anxiety and fear are psych feelings that is experienced by a person.
A child developed these feelings by learning from their own past experienced or by information obtained from their environment. If fear and anxiety can be learned by a child, thus the opposite term which is preventing the feelings is assumed can be also offered to learned.
This application actually being applied in the field of dentistry as modeling, but the exploration of how this process is due is often being ignored. Conclusion: Social learning theory provides an easy preventive approach and effective intervention that can be applied to children in years old to reduce dental anxiety.
Latar belakang: Kecemasan pada perawatan gigi merupakan hal yang paling sering dijumpai dan merupakan masalah yang dihadapi oleh dokter gigi sampai saat ini, terutama pada pasien anak. Berbagai metode penatalaksanaan kecemasan banyak tersedia, namun tidak satu pun metode yang dapat diterapkan secara luas.
Tujuan: Makalah ini disusun untuk membahas mengenai aplikasi teori belajar sosial dalam mencegah kecemasan pada anak saat perawatan gigi. Tinjauan pustaka: Rasa cemas dan takut merupakan perasaan psikis yang dialami seorang individu. Perasaan ini pada seorang anak lebih banyak didapat dari proses belajar dalam menyerap informasi berdasarkan pengalaman pribadi ataupun informasi dari lingkungan sekitar.
Bila rasa cemas dan takut dapat dipelajari oleh seorang anak, maka diasumsikan bahwa menghindari timbulnya perasaan ini dapat pula diajarkan pada anak. Aplikasi hal tersebut sebenarnya telah diterapkan di bidang. The porous structure of the scaffold and cell attachment was observed by scanning electron microscopy SEM. Biochemical measures of necrosis, cell proliferation, sulfated glycosaminoglycans sGAG content and extracellular matrix related gene expressions were quantitatively evaluated.
The cell proliferation data showed good cellular viability in tricopolymer scaffold and increased optical density for total DNA demonstrated that the cells continued to proliferate inside the scaffold. The sGAG production indicated chondrogenic differentiation. Chondrocytes treated with betulin expressed transcripts encoding type II collagen, aggrecan, and decorin.
To conclude, the substantiated results supported cell proliferation, production of extracellular matrix proteins and down-regulation of matrix metalloproteases and cytokine, in betulin treated scaffolds. Excessive intake of aluminum chloride in drinking water is associated with amyloid plaques and neurofibrillary tangles in the brain, which are the hallmark of AD.
We have evaluated brain energy metabolism in aluminum chloride AlCl3 mouse model of AD. The memory of mice was measured using Morris Water Maze test. The 13C labeling of brain amino acids was measured ex vivo in tissue extracts using 1H-[13C]-NMR spectroscopy with timed infusion of [1,C2]glucose.
The 13C turnover of brain amino acids was analyzed using a three-compartment metabolic model to derive the neurotransmitter cycling and TCA cycle rates associated with glutamatergic and GABAergic pathways. Exposure of AlCl3 led to reduction in memory of mice. The glutamatergic and GABAergic neurotransmitter cycling and glucose oxidation were found to be reduced in the cerebral cortex, hippocampus, and striatum following chronic AlCl3 treatment.
The perturbation in metabolic rates was highest in the cerebral cortex. However, reduction in metabolic fluxes was higher in hippocampus and striatum following one month post AlCl3 treatment. These data suggest therapeutic potential of RS to manage cognitive functions and memory in preclinical AD. Preliminary analysis of the sandstone accumulation situation at Sha -3 of the Paleogene Series Shakhetsze in the Khekou basin of the Tsziyan region. The main productive level occurs in sandstone beds in the Sha -3 subseries reaching thickness of about m of the Shakhetsze series.
The Bonan oil field was discovered in this region in The initially productive deposits were viewed as fluvial-delta; however, studies of recent years, including investigation of the sedimentation sequences and the structures that mark the surfaces of the microscopic level in the core sample, together with an analysis of borehole geophysical data, indicated that the sandy bodies of the productive beds in the basin must be viewed as deposits of turbidite flows and deposits of gravitational flows in channels.
Insofar as distribution of the turbidite sandstones differs significantly from the delta, this led to a review of the long-term trends in the neighboring fields. Berpikir dan Berperilaku dengan Rasa. Human as a complicated living creature has lot of feelings before making a reaction. In our daily life, we think a lot based on our feelings. We associate a stimulus with an unconscious physical or emotional response. A designer often needs to make a promotion, branding, and campaign for a product or something else.
So, it is important for designers to know their targets and behaviors. By understanding their target behaviors, it is easier to predict or to design the reaction and response when the product or campaign is launched. The understanding of the psychology study is important for a designer as well as understanding the other branch of study beside their own study about aesthetics.
When the designer understands a lot of things, they can make a creative, good and useful visual communication. Given that flight demand is forecast to reach 97 million passengers per year approx However, this presents many environmental constraints. Due to that the third runway will reclaim approximately hectares of the se so re-routing of speed boats and ferries has been planned. This includes one route that passes through the marine nursery inside the park.
This indirectly causes noise pollution that will affect marine life. Since dolphins rely on echolocation often discerned by a "click" sound to communicate and navigate, increasing marine traffic re-routing causes obscuring noises and acoustic communication interfering with echolocation, as well as collisions which lead to physical injuries. Underwater construction works involving techniques such as percussive piling may interfere with the dolphins' echolocation capability.
The data has been collected using a hydrophone by observing the noise frequency changes within the marine park. The noises come from a number of sources, including fishing boats, and speed boats, krill and around 20 estuarine fish species. The evaluation of four years has shown that noise pollution is increasing as indicated by the increase of frequencies around kHz and that it has caused disruption in regular dolphin movement irregular clicking sequence.
The forms tatsama or tadbhava, the meanings and the cultural connotations of these terms are herein thoroughly investigated. Full Text Available Enjoying the art exhibition is like enjoying a cup of hot sweet tea in the afternoon. There are mixed feelings that we enjoy when walking by the spaces and searching for the meaning of artworks. A very special exhibition is associated with the day of years of the birth of a great leader of Ngayogyakarta Hadiningrat, Sultan HB IX. The exhibition was loaded with messages of journey of Yogyakarta and HB IX in the political role scene in the early period of independence until the present realities of Yogyakarta.
Yogyakarta as the Kawah Candradimuka place to learn talented artists, reflected in the works of heavily loaded with the deepening of the concepts and ideas are very visionary and imaginary. Sentuhan Rasa di Balik Makna Laba. Full Text Available This study aims to reveal the meaning of profit according to the existing customs, traditions and cultures of Aisyiyah hospitals. This qualitative study employed ethnographic approach which is realist in nature, and was geared to find out the meaning of profit through customs and rituals that had been practiced in the hospital for a long time.
The research found that profit in the hospital is, first, interpreted from the abstract dimension, that is in the form sense. Second, profit is a form of gratitude and happiness sense. Third, profit serves as a spreader of happiness. Generally, commercial MSG products did not specify the amount of a certain dose to produce palatable food. This problem could lead to uncontrolled and excessive use of MSG by consumers.
The aim of this study was to determine the values for the detection and preference threshold of umami taste from commercial MSG products at different salt level. The detection threshold was determined using R-index method in salt solutions. The preference threshold was determined by using hedonic rating in food model. A food model selected in this case is spinach soup that is commonly consumed by Indonesian. The salt concentrations for detection and preference threshold experiment were 0.
Detection threshold value using R-index method for 0. Different salt concentrations leads to differences in the values of threshold preferences and detection threshold of the umami taste of MSG. Increasing salt concentration tends to decrease the detection and preference threshold of umami taste from MSG. This research results could be used as the basic information in food product formulation such as seasoning and condiment using mixtures of salt and MSG.
Full Text Available The purpose of this study to analyze the factors affecting the intentions of alumni who are willing to assist their university, whether financial or non-financial. The intentions of alumni are consequences of satisfaction and trust, where satisfaction and trust are the mediating variables of academic experience, current income, relation and agency image.
The study was conducted through a survey method that included respondents living in Jakarta, with middle and upper class economic levels. The sampling technique used is proportionate stratified random sampling. The finding from this study is the antecedent factors of satisfaction and trust including academic experience, income, relationships, and institution image that are proven to be positive and significantly influential in satisfaction and trust, partially or simultaneously.
The behavior intention as a consequence of trust and satisfaction are found to be positive and significant although only moderate. Therefore, for further research it is advisable to explore motivational factor, family education values and cultural factors as antecedents of behavior intention.
Full Text Available. Full Text Available iqytlsdrdwksmlpsieaslralikigaieasipis gfkpgnqdtieqyikaiksngyksnqtvilsahqmgscrmgssksnsvvnengeswdvkr lfiadgsvl Full Text Available uence update Full Text Available pdate Full Text Available equence. Fermented milk is milk processed product that to be one source of nutritious food for humans. The action of food component such as flavor is accepted, sense of taste and smell generated complex assessment of food flavors in the mouth.
The flavor components of fermented milk together and interact with each other when consumed and cause the perception of taste between like or dislike. This is an important factor in developing diversification of fermented milk product so as to attract customers other than in terms of aspects of nutrition and health.
Flavor is one of the most important criteria in the acceptance of a food ingredient. During processing and storage flavor change easily. This study used gas chromatography to detect the formation of the active component of the flavor of fermented milk. The purpose of this study was to determine the active components in fermented milk which is the formation of flavor.
This study uses a Likens - Nickerson distillation stage concentrated with Vigreux column and identified by Gas Chromatography Mass Spectrometer. Gas chromatography has identified that the class of acids, alcohols, esters and alkanes group forming an active component in the flavor of fermented milk although relatively varied. In yoghurt, acid found in relatively high amount of alcohol is more varied in its kind. Yogurt with single culture L. Volatile components were detected mostly in kefir acids, alcohols, esters and alkane derivatives.
The curd is dominated by acidic components in addition to alcohol and aldehyde. Full Text Available Efforts to strengthen the character become the basis in the implementation of the curriculum Application of the curriculum provides a paradigm shift, which in the end result of learning students not only master the knowledge but also master the attitude and skills.
One of the two characters developed is curiosity and social care. To form the character, it needs an educational instrument such as a competent teacher, adequate learning resources, and the most important is the action of learning in the form of approach, model, method, or appropriate learning strategy.
So the application of discovery learning model with scientific approach. Which model is effective and efficient in bring up the character of curiosity and social care. Full Text Available The aim of this study was to evaluate the main motor and functional changes before and after physical therapy of a patient with spinal cord injury caused by diving in shallow water.
We analyzed previous records of a patient with spinal cord injury by diving in shallow water, who had rehabilitation at the Rehabilitation Clinical of Oeste Paulista, between and , attending two one-hour-sessions a week. The patient improved muscle strength as consequence of the rehabilitation program. The treatment also helped the patient improve functionality observing the development while being transferred, in other words, during position changes, between and It is understood that patients with spinal cord injury show muscle strength and functional pattern improvement when undergoing physical therapy.
The results were evaluated for its contribution to improve nutrient content and to add more variation on fermentation product for consumer choice. The proportion of basic materials to salt and water were varied depending on the kind of fish and the optimum values were chosen. Fermented teri rucah needed addition of one part of salt and two parts of water, or one part of salt and one and half parts of water; fermented udang rucah needed addition of one part of salt and one part of water, or nine-tenth parts of sah and one-tenth parts of water, forevery three part of basic material.
All fermented products were analyzed for proximate nutrient contentand vitamin B content Fermented teri rucah was higher in protein and vitamin B content compared to that of udang rucah. In general liquefied fermentation increased vitamin B content by 2 to 4 times. Incorporation of the produds into traditional cooking recipes need to be explored and socially marketed. Kultuurivarade halduse organiseerimisest.
Kultuurivarade praktilisest haldamisest. Genealoogilisest materjalist. Quasi experimental were used in this study using pre test and post test design with control group. Samples, 20 respondents in 2 groups were recruited using consecutive sampling.
The intervention group received SEFT intervention combined with analgesic therapy and the control group given only analgesic therapy. SEFT intervention implemented after administrating analgesic, for minutes every day during five days. Pain was measured using numeric rating scale NRS. The combination SEFT intervention and analgesic therapy was more effective than only analgesic therapy. SEFT can be employed for cancer patients to relieve their pain. This research is a classroom action research PTK , which consists of two cycles.
The data collecting were using observation sheets, questionnaires and te Full Text Available This study aimed to understand the characteristics of the fear of failure based on a young entrepreneurial career interests of students.
This research is a qualitative research descriptive narrative with a phenomenological approach to the entrepreneurial young entrepreneur student member of the Indonesian Young Entrepreneurs Association at the Education University of Indonesia. Results from this study is the fear of failure that is divided into three major themes of the careers of the consequences, consequences on the psychological and financial consequences to the student.
Property booms and bubbles: a demolition strategy - towards a tabula rasa? There is a tendency to perversity in the effects of public policy for the built environment at large and with respect to specific sectors. This review paper addresses the unanticipated effects arising from the land and property development incentives which prevailed before the current economic.
The acquisition of biological knowledge during childhood: Cognitive conflict or tabula rasa? Clinical interviews were conducted with three elementary school children, who varied in age but not in family or school environment, to determine the extent to which they held naive misconceptions about important biological topics and to determine agewise trends in the development of biological knowledge.
Does early biological knowledge acquisition follow a pattern of spontaneous naive theory construction and cognitive conflict or does it follow a pattern of gradual accretion to an initially blank slate? Contrary to findings in the physical sciences, little evidence was found for biological misconceptions as knowledge acquisition appeared to more directly follow the gradual accretion hypothesis with the primary source of that knowledge adult authority rather than personal experience.
However, conceptual change teaching is still advocated due to its ability to provoke students to consider and test alternative conceptions even if they are not their own as a means of encouraging the development of important general reasoning patterns utilized in the testing of causal hypotheses.
Samadai, Marsa Alam, Red Sea. The data were collected from October until. September using surface observations. Four objectives were studied: arrival and departure time of dolphins, distribution of dolphin movements within the Cai, Yutong; Zijlema, Wilma L.
We investigated the effects of both ambient air pollution and traffic noise on adult asthma prevalence, using harmonised data from three European cohort studies established in HUNT3, Lifelines and UK Biobank. Residential exposures to ambient air pollution particulate matter with.
Multivariate logistic regression models were fitted to assess the effects of each exposure on lifetime and current asthma prevalence. Noise exposure was not significantly associated with asthma prevalence. This study suggests that long-term ambient PM 10 exposure is associated with asthma prevalence in western European adults.
Traffic noise is not associated with asthma prevalence, but its potential to impact on asthma exacerbations needs further investigation. Speeding up detection of SHA -1 collision attacks using unavoidable attack conditions.
That is, an algorithm that detects whether a given single message is part of a colliding message. The fatigue design of the mast arm structures and connections vary significantly based on the Category of Importance factor adopted and the load cases for fatigue design loads. Consideration should include the cost and size of the structures for both Eastern Thessaly region Central Greece shows numerous evidences of seismic activity ranging from structural, morphological, palaeoseismological, archaeological and historical.
In the present note, we focus on the latter two aspects. A fundamental source of historic data are the "Chronicles" of the monasteries of the area. Doubtless, the most important ones are those located in the Meteora region western Thessaly. In the "Chronicles" of these monasteries few events are reported relative to the investigated region and particularly the August , occurred in the area of Larissa, the , the November 9, and the August 28, Maximum inferred intensity of the three latter earthquakes has been estimated of the VIII degree.
Based on the tectonic setting of the possible seismogenic structures, these events are tentatively located in the Tyrnavos Basin, while no other events are known in this sector neither before the 16th century nor in more recent times, except the March earthquake occurred East of Larissa. Archaeological information from the broader area concerns several sectors.
According to the historian Rhianos 3rd century BC , the town was still there during the Classical Period 5th-4th century BC but according to Strabo it was disappeared at the end of the 1st century BC. As a consequence, frequent flooding events have continuously enriched the soil and probably enhanced the productivity of the area thus making it particularly appealing for farming. The first excavations revealed that many blocks belonging to former buildings and stones with inscriptions were chaotically accumulated in hollows.
On the other hand, the existence of this temple is documented during the third Macedonian War first half of the 2nd century BC without any doubt and consequently the destruction of the buildings must have occurred during this time window and they were rebuilt at some distance from its original location. The theatre was built at the beginning of the 3rd century BC during the Early Hellenistic times but following the traditional plan and architecture of the Classical time koilon, orchestra and scenic building.
During the 2nd century BC was added a Doric style proscenium in front of the scenic building. During the Imperial time last 10 years of the 1st century BC , the theatre underwent a deep re-handling due to a different use as arena. In particular, a new and larger proscenium was built as a monumental decoration holding three frontispice with dedications of the Larissa people to the Emperor August, to Tiberius as "benefactor and founder".
During the excavations of the theatre, several evidences of damages of the building have been observed. Probably the most important and more impressive damages are represented by the displacement of some of the blocks of the walls and the rupture of some of the blocks. For example, some of the blocks show a typical concoid fracture clearly induced by a strong mechanical shock occurred in one of its corners.
These rupture conditions are likely to be associated to the dynamic motion of the overlying block which acted as a hammer due to a strong acceleration. Numerous blocks are also dislocated and rotated. According to the size of the shifted blocks, their weight and the amount of displacement they suffered, we can tentatively estimate the peak acceleration occurred in the area and possibly the direction of the seismic waves.
The collected archaeological and historical data, have been also compared with the available palaeoseismological data, while possible inferences for the seismic hazard of the region will be discussed. Over the past two decades, wind induced fatigue cracking of highway signs, luminaires, and traffic signal support structures have been increasingly reported all over the United States.
While fatalities associated with these failures have been limited As a member of the Chickasaw, the author pondered what he would find in the museum that would represent the Chickasaw Nation. Would the museum reflect his people in all their diversity?
Would he see something of…. We present a new concept of biclique as a tool for preimage attacks, which employs many powerful techniques from differential cryptanalysis of block ciphers and hash functions. The new tool has proved to be widely applicable by inspiring many authors to publish new results of the full versions Full Text Available Rock al Parque Varios autores.
Buying decision made by customer based on their beliefs is the right decision. There is a brand equity, if thecustomers have the brand awareness, perceived quality, brand association and brandloyalty. Full Text Available The purpose of the study is to produce the tourism geography module based on the Lombok tourism packages that is prepared in accordance with the module design of C Michael and Stephen J. Based on the results of validation and field trials, the numbers of scores are obtained namely: a the assessment of the expert design towards the components of the module is The average value of the results of validation and field trials, the module is developed and appropriately used as learning sources with percentage Michael Hall dan Stephen J.
Kualitas produk diketahui melalui hasil tanggapan dari dosen pengampu matakuliah dan mahasiswa pada saat uji lapangan. Investigation of antihyperglycaemic activity of banana Musa sp. Nanjangud rasa bale pseudostem in normal and diabetic rats. Different parts of banana have been in use in conventional medicinal formulations since ancient times. Its role as an antihyperglycaemic agent has also been studied. This study was aimed at explaining the mechanism of hypoglycaemic effect by ethanol extract of banana pseudostem EE.
Additionally, studies on the active components involved in the effect have also been attempted. Hence the results extend a foundation to the future prospects of the food-derived enzyme inhibitors in treatment of diabetes. Identification has been made of synthetic dyes contained in the powder drink orange flavor in Chromatography Paper at the Center for Food and Drug Administration. From the results of the analysis obtained dye Sunset Yellow and Tart Effects of morpho dynamics in shallow waters over pipeline facilities; Efeitos da morfodinamica em aguas rasas sobre instalacoes de dutos.
Toldo Junior, Elirio E. The success in developing of the oil industry operating in offshore-onshore terminals, connected by pipelines with the facilities of the coastal zone, can be attributed partially to the beach morpho dynamic monitoring.
This study represents a solution to the concerns of the technical operations in coastal zones because it minimizes the impact of the petroleum production and it assures the environmental protection associated to the risks of the pipelines breaking. This impact type results mainly of the vertical and horizontal displacements of the beach, from the coastal dunes to the shore face.
The mobility of the profile is associated to the magnitude of the sedimentary processes, which reproduce naturally or not, in scale of time that can vary among few days, years or decades. For the monitoring and interpretation of the beach profile mobility the following methods are recommended: calculation of the closure depth with base in the wave data; bathymetric survey with sled; calculation of the equilibrium beach profile, and monitoring of the variations of the shoreline using satellite images, GPS or aerial photography.
This study aims to provide security solutions for implementing electronic medical records EMRs. Majority of the required security features of EMRs were noted. The methods used were tested against each of these security features. In implementing the system, the combination that satisfied all of the security features of EMRs was selected.
Secure implementation and management of EMRs facilitate the safeguarding of the confidentiality, integrity, and availability of e-health organization systems. Health practitioners, patients, and visitors can use the information system facilities safely and with confidence anytime and anywhere. After critically reviewing security and data transmission methods, a new hybrid method was proposed to be implemented on EMR systems. This method will enhance the robustness, security, and integration of EMR systems.
Noise and vibration reduction technology in hybrid vehicle development; Hybrid sha kaihatsu ni okeru shindo soon teigen gijutsu. Accomplishing both environmental protection and good NVH performance has become a significant task in automotive development The first-in-the-world hybrid passenger car of mass production. It also mentions application technology of low rolling resistance tires with light weight wheels and recycled material for sound proofing. Supply of carbon fiber for a natural gas car tank; Tennen gasu sha tanku muke tanso seni no kyokyu.
Mitsubishi Rayon shared investment with the Dynatech Company in Canada to produce carbon fiber tanks used in natural gas cars, and attempted to monopolize the supply of carbon fibers for tanks. As for the natural gas automobile with low air pollution and exhaust of carbon oxide compared to gasoline automobile, a heavy CNG tank is the bottleneck of its popularization, and its weight could be reduced to one fourth of a steel tank by using carbon fibers.
In Japan, only steel tank has been licensed until now. Selling will be increasing in Japan by the co-operation with the Dynatech Company since this carbon fiber can be used from this April. International students bring racial attitudes and group preferences that affect campus climates. Thirty-five out of…. Dewasa ini keberadaan sektor pariwisata, terutama dibidang perhotelan telah banyak menyumbangkan devisa bagi negara.
Hal ini terlihat semakin pesatnya persaingan bisnis dibidang ini perhotelan. Dengan seiring berjalannya waktu, kini hotel semakin meningkatkan kualitas dan produk serta jasa dari pelayanannya. Banyak atau sedikitnya jumlah kunjungan tamu dapat dilihat dari baik buruknya pelayanan hotel tersebut. Dengan memperhatikan seluruh area hotel dan meningkatkan hygiene dan sanitasi p Banana is an extensively cultivated plant worldwide, mainly for its fruit, while its ancillary product, the banana flower is consumed as a vegetable and is highly recommended for diabetics in the traditional Indian medicine system.
This study is based on an investigation of the in vivo antihyperglycaemic activity of Umbelliferone C1 and Lupeol C2 isolated from the ethanol extract of banana flower EF in alloxan induced diabetic rat model. HbA1c extent was reduced whereas levels of insulin and Hb were increased. Both the extract and compounds wielded positive impacts in diabetic rats by reversal of altered activities of hepatic marker enzymes viz. Besides these, the treatment increased the activities of enzymatic and non-enzymatic antioxidants in the serum and liver.
Full Text Available Banana is an extensively cultivated plant worldwide, mainly for its fruit, while its ancillary product, the banana flower is consumed as a vegetable and is highly recommended for diabetics in the traditional Indian medicine system. Evaluation of waste concrete road materials for use in oyster aquaculture : [research summary]. The SHA also intends to increase the use of : recycled materials and to use products South Africa is one of the most 'unequal' societies in the world.
Adolescence is a unique time-point during which intervention may lead to improved mental health and reduced social problems later. The study objective was to assess mental health disparities in a representative sample of adolescents growing up in South Africa.
Self-ascribed ethnicity was determined using procedures similar to the South African census and previous national surveys. Respondents self-identifying as 'black' or 'coloured' were disadvantaged across most indicators. After adjusting for confounders, relative to white children, relative risk RR of CMD in black children was 2. Putative mediators violence, racially motivated bullying, social support, self-esteem partially accounted for differences in CMD and fully for PTSD.
Adolescent mental health inequalities in Cape Town are associated with material disadvantage and self-identification with historically disadvantaged groups. Presentation of electric motor and motor control technology for electric vehicles and hybrid vehicles; Denki jidosha hybrid sha yo motor oyobi motor seigyo gijutsu no shokai.
The authors have developed a motor drive system for electric vehicles and hybrid vehicles. This system consists of a permanent magnet type synchronous motor, an inverter using insulated gate bipolar transistors IGBTs and a controller based on a single-chip microcomputer.
To achieve a compact and light weight synchronous motor, an internal permanent magnet type rotor structure was designed. This paper presents motor control technology for electric vehicles, such as an optimization method of field weakening control and a new current control method. Fa-fa-fa-fa, de doo doo doo, de da da da, sha la la la lee : What is the optimal syllable in improvised singing?
The aim of this paper is to describe and account for the optimal syllable structure in improvised singing without lyrics. Improvised singing has an overall relaxed character and it is abstracted from meaning.
Furthermore, singing in general involves an exaggerated articulation of speech sounds. Among them are 1 incorporating multi-target scenarios into the MITM framework, leading to faster preimages from pseudo-preimages, 2 a simple precomputation technique that allows for finding new Fall is a common cause of disability and death in old adults, and much research has been focused on identifying risk factors and developing preventive measures. Yet the majority of preceding research has been focused on physical performance.
This study aims to evaluate the association between fall and depressive symptoms in community-dwelling elderly. Cross-sectional data of men and women was collected from old Korean adults living in Seongnam, Korea. Geriatric fall assessment was conducted by self-report questionnaires. Results indicated that depressive symptoms were associated with both fall and fear of falling in old adults. A clear gender difference was newly discovered, as depression played a stronger role in women.
These results imply that clinicians should consider the negative affect of geriatric patients when assessing fall risk. Also, measures against depression might be effective in reducing falls. Full Text Available South Africa is one of the most 'unequal' societies in the world. Qanun raqam 68 li-sanat fi sha 'n al-ta'lim al-am Law No. This document is an English-language abstract approximately 1, words of a law passed by the UAR legislation covering elementary, preparatory, and secondary education.
This law covers general regulations common to all three stages of education, the objectives of which are defined as the general intellectual, physical, moral, civic and national…. The security of the widely-used cryptographic hash function SHA 1 has been impugned. We have developed two replacement hash functions. Mineralogical and chemical characterization of iron-, manganese-, and copper-containing synthetic hydroxyapatites.
The substitution of metals into SHA suggests that metal- SHA materials are potential slow-release sources of micronutrients for plant uptake in addition to Ca and P. The study of shallow impurities in semiconductor heterostructures, such as quantum and superlattices, has been of continuous interest over the last years.
Successful comparisons between experimental results photoluminescence: N. N Ledentsov et al. A 54, and theoretical calculations [L. Oliveira and G. Mahan, Phys. B 47, ] constitute a strong motivation for an in-depth theoretical study. We present a variational calculation of the binding energies of shallow donors in a Ga-As-AlGaAs quantum well.
The density of impurity states, intra-donor transition strengths and the infrared absorption spectra are calculated for some of these excited states and results compared with previous theoretical [S. Fraizzoli, F. Bassani, and R. Buczko, Phys. B 41, ] and experimental works [N. Jarosik et al. The assumption of perfect supports fixed or pinned foundations for the boundary conditions of reinforced concrete buildings has been used for many years by structural engineers.
This fact is mainly attributed to the great difficulties faced in the past, when designers needed to calculate buildings by using manual methods. Nowadays, realistic analysis that takes into account the deformability of the adjacent soil foundation is possible,based on the development of powerful computers and computational software packages.
However, many structural engineers still use the same simplified boundary conditions widely used in the past. The main explanation for this problem may be the lack of information and models available in the literature, as well as the lack of interaction between structural engineers and foundation engineers. In this context, the present paper aims to present practical recommendations for applying the soil-structure interaction.
Additionally, based on some practical examples, this paper shows that the rigid support hypothesis may lead reinforced concrete columns to significant force distortions. Full Text Available The expansion of Darwinism stimulated a great deal of interest about the phenomena associated with heredity during the years. Spanish anarchists, even though they were not specifically interested in the causes of variation and heredity, manifested an explicit concern about its potential effects.
In fact, the analogy between memory and heredity, normally linked with Neolamarckian theories, proved to be extremely useful to rationalise those aspects of social and historical reality more difficult to accept from a libertarian point of view. Full Text Available This research used duck eggs age one as subject day. There were two factors analyzed here.
The first was the amount of palm sugar which consisted of 25 grams, 50 grams, and 75 grams. The second factor were the storage duration which consisted of 3, 4, and 5 weeks. The nutrient content parameters measured were rates protein, fat and ash content. Sensory quality parameters measured were color and taste. However, organoleptic test showed that palm sugar addition did not influenced color and taste of salted duck egg significantly.
Energy conservation and modernization plan for Chhatak Cement Co. Chhatak Cement sha shoene, kindaika keikaku. With an objective of saving energies and reducing greenhouse gas emission, discussions were given on a modernization plan for the Chhatak cement factory in The People's Republic of Bangladesh. The Chhatak cement factory having a nominal production capability of , tons a year uses mainly wet-type long kilns of old type, consuming a great amount of natural gas. The present plan has discussed adoption of the Japanese energy saving technologies.
The technologies use a vertical roller mill for raw material pulverization, a suspension preheater and a short kiln for clinker sintering, a grate cooler for clinker cooling, and the pre-crushing system. This will mean the annual reduction of about 22, tons as converted to crude oil. The CO2 reduction amount would reach 51, tons a year. The result of the financial analysis according to the case studies appears severe, wherein reduction of the various expenses is desired possibly by the finance from Japan with generous conditions.
Dai 28 kai sekitan kagaku kaigi dai 91 kai cokes tokubetsukai. As to coal science, studies are mainly on the brown coal two-stage liquefaction BCL method, and data on the pilot plant and PSU are reported. Concerning bituminous coal liquefaction, PSU data mostly including the NEDOL process, and characteristics of liquefaction residue and its effective utilization by thermal decomposition are reported.
Regarding the liquefaction mechanism, an experimentally extensive study on catalyst, solvent and reaction conditions is made using model materials and coal itself on the bench scale and also in the pilot plant. Engineering subjects on residue, solvent deashing, scale attachment and coprocessing are also reported. Relations of decomposition process to coal chemical structure changes and reaction conditions are investigated. As to coal gasification, studies, which are not many, are conducted on material balance, heat balance, and image characteristics of char for gasification and factors controlling reactivity.
Fiscal research report. Basic research on joint implementations promotion Feasibility study of modification for Tehran Cement Co. The feasibility study was started upon a request made by the Iranian Ministry of Energy involving the No.
It was then concluded, after assessing the degree of urgency of supply and demand and the magnitude of loss due to reduced production because of the on-site modification work, that it was not practical to begin the project immediately. Under the circumstances, various studies were made about the feasibility of modification of the whole production process of the No.
The procedure will consist of Phase I wherein the No. Under this procedure, the modernization of the Tehran Cement Co. After the completion of the project, an annual yield of 3. Application of CDM clean development mechanism to this project will be extremely effective in reducing greenhouse gas and in improving profitability. This project is aimed at energy-saving diagnosis of 30 energy-intensive manufacturing plants in Thailand, to draw the project plans and clarify, e.
The 30 plants analyzed are 6 metal-related plants, 3 non-ferrous plants, 5 chemical plants, 6 ceramics plant, 4 textile plants, 4 food processing plants and 2 pulp plants. Two or more feasible energy-saving measures are studied for each plant. A total of improvement measures approximately 6 on the average for each plant are identified as the ones related to energy-saving and operation controlling techniques.
The measures of high cost-effectiveness are use of an appropriate pressure for air compressors and resting of transformers on non-working days. Sustainable practices and related performances at state highway agencies. This report identifies seven ways in which an SHA can harm the environment: 1 excessive consumption of virgin materials; 2 unnecessary levels or amounts of storm water runoff; 3 release of environmental contaminants by SHA employees and conract The products were characterized by x-ray diffraction, field emission scanning electron microscopy, thermogravimetric analysis, mechanical testing and biomimetic mineralization.
Penerimaan panelis menunjukkan bahwa perlakuan tepung ikan gabus berpengaruh nyata p0,05 terhadap aroma, rasa , warna dan keseluruhan biskuit. Kata kunci: Biskuit fungsional, subtitusi, fortifikasi. Callithamniella flexilis Baardseth, Cryptonemia seminervis C. Agardh J. Agardh, Cladophora pseudorupestris C. Hoek e Cladophora cf.
Greater knowledge of the macroalgae from rocky shores is essential to monitor and manage marine coastal conservation units. The present study aimed to improve the taxonomic survey of seaweeds from the Picinguaba unit and to evaluate the suitability of sampling methodology for rocky shore communities in this conservation unit.
Thirteen sampling stations, situated between Almada and Cambury Headlands, were studied in summer ; this part of the PESM coastal zone is subject to anthropogenic interference. We carefully searched for macroalgae in different rocky habitats, from the sublittoral fringe towards the sand domain.
Aiming to standardize sampling effort at each station, the same specialist searched for macroalgae over a 20 m horizontal extension of the rocky shore, for one hour, by apnea diving. Hoek and Cladophora cf.
These species are described and illustrated here. Sixty four species are new occurrences for the rocky shores of PESM. In conclusion, for monitoring purposes of the Picinguaba coastal environment, we recommend sampling rocky shore macroalgae yearly, in the summer, using the methodology described in this paper. Dementia-specific quality of life instruments and their appropriateness in shared-housing arrangements--a literature study.
Shared-housing arrangements SHA in Germany are a specific type of housing arrangement that belongs to the global concept of small-scale living arrangements. This caring approach comprises characteristics of both home and institutional care for persons with dementia. To evaluate the impact of SHA on the quality of life QoL of residents, an appropriate setting- and dementia-specific QoL instrument is needed.
After a comprehensive literature review, existing dementia-specific QoL instruments were evaluated to determine whether any have been specifically designed for or applied in SHA. Additionally, each domain of the instruments was matched with the core domains of SHA.
None of the existing instruments was identified as having been developed for SHA. For the first time, a basis has been created for valid QoL evaluations of residents with dementia living in SHA. The 4 identified instruments are considered applicable in SHA. Conducting a performance test and evaluating further attributes according to the Scientific Advisory Committee of the Medical Outcomes Trust e.
Fiscal report on basic research for promotion of joint implementation programs. Heat and power plant reconstruction project for Yuzhmash Company co-generating plant, Donepropetrovsk City, the Ukraine; nendo Donepropetrovsk shi Yuzhmansh sha Heat and Power Plant Reconstruction Project chosa hokokusho.
To be newly installed are three gas turbine power generators rating: 26MW, main fuel: natural gas , three waste heat recovery boilers additionally fired boilers, 2-pressure natural circulation type , and one 40MW water circulation type mixed pressure steam turbine power generator including a bleeder for co-generation.
Profitability is assessed using EIRR economic internal rate of return when the exchange rate is set at 4. Basic investigation on promotion of joint implementation in fiscal Energy saving projects at two steel making companies in Fushun City in China; nendo kyodo jisshi nado suishin kiso chosa hokokusho. Chugoku Fushun shi ni okeru tekko gaisha 2 sha no shoene project chosa hokokusho.
With an objective of saving energy and reducing greenhouse gas emission, investigations and discussions were given on two steel making companies in China. Discussions were given for Fushun Special Steel Co. As a result of the discussions, it was revealed that the unit requirement for electric power used at Fushun Special Steel can be reduced largely, and so can the fuel used at Fushun New Steel. Duis ac turpis. Hence we could say that bitcoin binary options are binary options traded in Bitcoins or that in which you can fund and withdraw your money in bitcoins Bitcoin Binary Options are financial instruments that allow you to predict if the price of Bitcoin will rise or fall in a bitcoin option binary specific amount of time.
Open to all US residents. Play Instructions Account. Prime Option Trade allows you to actively trade most popular cryptocurrencies such as Bitcoin, Ethereum, Ripple, Litecoin and more, profit from market rallies and declines, or hedge your existing cryptocurrency holdings Nadex will offer daily and weekly bitcoin binary options contracts, taking prices from the bitcoin price index published by TeraExchange, a derivatives trading platform.
If you think it will be, then you buy The binary options trading platform on offer by OptionBit is not. Binary options trading can bring substantial income in the shortest time possible. Bitcoin options. As most Binary Options traders can tell you, there are a number of factors that impact on the price of a binary option Trading on Binary Options bitcoin option binary and Bitcoin has never been easier.
Stockbrokers are seeing the value in trading BTC …. Total earned by our traders in You can use your Bitcoins for binary options trading in two different ways. Buy a binary option, it can be a Call option or Put option and for the right prediction, you can make a profit.
The income of our traders. Available Options. With no bank as a bitcoin option binary middleman in exchange, things become more complicated; so hackers and con men have had a heyday Binary Options is a financial instrument used to make profit by predicting an asset's price movement currencies, shares, commodities.
Binary options in cryptocurrency. Donec sit amet eros. Sed laoreet aliquam leo. Binary bitcoin option binary options in cryptocurrency.
Sebagai ringkasan, berdasarkan sifat-sifat glukomannan, maka penggunaan atau manfaat zat tersebut antara lain : Bahan Pembuat LemBerdasarkan sifat merekat dari pastanya, tepung mannan lebih baik jika dibandingkan dengan bahan perekat lainnya misalnya tepung beras. Pada suhu yang rendah daya rekatnya tidak hilang sehingga banyak digunakan dalam industri perekat kertas. Pelapis Kedap AirTepung mannan juga dapat digunakan sebagai bahan dalam pembuatan alat-alat yang kedap air misalnya pembuatan tenda-tenda, jas hujan, payung dari kertas dsb.
Daya Rekat CatDi industri cat, larutan mannan dapat digunakan untuk meningkatkan daya rekat cat pada tembok, juga untuk mencegah kelunturan bila dioleskan didinding terutama jika ditambah dengan alkali. Pembuatan TabletDi industri farmasi, larutan mannan digunakan sebagai bahan pengikat dalam pembuatan tablet.
Pada pembuatan tablet dibutuhkan suatu bahan pengisi yang dapat memecah tablet di dalam lambung. Biasanya digunakan pati atau agar-agar yang mempunyai sifat mengembang dalam air. Karena mannan mempunyai sifat mengembang yang besar dibanding pati maka pemakaian tepung mannan dalam pembuatan tablet "Curcuma" akan memberikan hasil yang lebih baik. Media Pertumbuhan MikrobaSifat mannan yang mirip dengan agar-agar dapat digunakan di dalam bidang mikrobiologi sebagai media pertumbuhan mikroba, misalnyaPenicillium atau Actinomycetes.
Untuk pembuatan media dari tepung mannan ini tidak dijelaskan secara terperinci. Zat PengentalDi industri makanan, tepung mannan dapat digunakan sebagai zat pengental misalnya dalam pembuatan sirop, sari buah dan sebagainya.
Produk MakananTepung mannan dapat dibuat makanan yaitu dengan pencampuran larutan mannan dan air kapur. Produk yang dihasilkan dikenal dengan nama "konnyaku" dan "shirataki". Di Indonesia produk "konnyaku" dan "shirataki" sudah dipasarkan pada beberapa toko swalayan di Jakarta, Bogor dan Surabaya. Jika dikonsumsi bahan makanan ini dapat berperan sebagai "dietary fiber" yang dapat menurunkan kadar kolesterol dalam darah.
Penguat TenunanDi industri tekstil, tepung mannan dapat digunakan sebagai bahan yang dapat mengkilapkan dan memperkuat tenunan pengganti kanji. Ekstraksi GlukomannanAda dua cara yang biasa digunakan untuk mengekstraksi mannan dari umbi iles-iles atau gaplek iles-iles yaitu secara mekanis dan cara kimia. Ekstraksi secara mekanis dapat dilakukan dengan tiga cara yaitu peniupan, pengayakan dan penyosohan sedangkan secara kimia menggunakan bahan kimia untuk melarutkan glukomannan.
Sifat-sifat Umbi Iles-ilesSifat umbi iles-iles yang dianalisa adalah kekerasan umbi, analisa komposisi kimia dan analisa mikroskopis. Kekerasan UmbiPengukuran kekerasan umbi dilakukan pada umbi iles-iles yang belum dikupas kulitnya. Pengukuran kekerasan umbi dilakukan pada umbi yang belum dikupas kulitnya.
Pengukuran dilakukan dengan meletakkan umbi di bawah jarum, kemudian jarum diatur sehingga tepat menyinggung umbi. Tombol ditekan sehingga jarum menembus umbi. Waktu yang digunakan selama 10 detik. Skala menunjukkan kedalaman jarum menembus umbi. Komposisi Kimia UmbiAnalisa ini bertujuan untuk mengetahui komposisi kimia umbi iles-iles. Analisa dilakukan terhadap kadar air, kadar abu, kadar protein, kadar lemak, kadar serat kasar, kadar pati, kadar amilosa, kadar gula dan kadar mannan.
Khusus untuk analisa kadar mannan dilakukan terhadap umbi iles-iles putih Amorphophallus variabilis dan umbi iles-iles kuning A. Disamping itu untuk umbi iles-iles putih dilakukan pula analisa kadar mannan dari umbi yang tua dan umbi yang muda. Pemilihan umbi iles-iles tua dilakukan dengan memperhatikan kondisi umbi yaitu bila tangkai batang mudah dipatahkan dan terlepas dari umbinya.
Jika umbi dibelah maka bagian penampang hasil belahan tersebut memperlihatkan butiran-butiran mannan. Bagi umbi muda tangkai batang masih sulit dipatahkan Analisa MikroskopisPengamatan mikroskopis dilakukan terhadap penampang melintang dan membujur umbi iles-iles.
Pembuatan preparat dilakukan dengan membuat sayatan tipis umbi ilesiles kemudian diletakkan di atas gelas obyek dan diamati di bawah mikroskop dengan pembesarn dan kali. Diamati bentuk dan susunan sel-sel mannan di dalam umbi iles-iles. Ekstraksi PatiProsedur ekstraksi pati iles-iles sampai saat ini belum dilaporkan. Karena umbi segar yang digunakan untuk analisa komposisi kimia telah dikeringkan dengan alat "freeze drier" maka pembuatan pati iles-iles dilakukan dari bahan kering tersebut.
Potongan umbi yang telah kering dihancurkan dengan menggunakan alat penghancur merk "Maulinex" sehingga diperolah tepung iles-iles. Teung tersebut ditimbang dan ditempatkan dalam gelas piala. Selanjutnya ditambahkan air kran sedikit-demi sedikit sambil tepung tersebut diremasremas.
Perbandingan air yang digunakan dengan berat tepung iles-iles adalah Larutan yang diperoleh diendapkan selama 24 jam pada suhu kamar Endapan yang diperoleh dicuci dengan air kran sambil diaduk-aduk dengan batang pengaduk dari gelas, lalu diendapkan lagi selama 24 jam pada suhu Perbandingan air yang digunakan dengan berat tepung adalah Pencucian ini diulang sampai lima kali.
Endapan pati yang telah dicuci dikeringkan dengan sinar matahari. Pengeringan menggunakan nampan seng. Dilakukan pengamatan terhadap tepung pati yang dihasilkan meliputi rendemen dihitung dari umbi segar , kadar air, kadar pati, kadar amilosa dan derajat putih. Ekstraksi Mannan Glukomannan Ekstraksi basah dilakukan dari umbi iles-iles segar dan umbil iles-iles kering dengan menggunakan metode dari Balai Penelitian Kimia, Semarang seperti yang diperlihatkan pada gambar 7. Ekstraksi dari Umbi KeringPersiapan bahan untuk ekstraksi ini dilakukan dengan mengiris umbi iles-iles segar setebal mm.
Umbi terlebih dahulu dibersihkan dari tanah dan kotoran-kotoran yang melekat. Mata tunas yang terdapat pada umbi dihilangkan kemudian dikupas. Tepung mannan komersil yang dihasilkan diamati sifat-sifatnya. Pengamatan dilakukan sama seperti pada tepung mannan hasi ekstraksi secara basah ekstraksi kimia. Persiapan Contoh untuk Analisis KimiaUmbi iles-iles segar dikupas kulitnya kemudian dipotong-potong sampai cukup halus untuk dapat dihancurkan dengan menggunakan mortar.
Satu gram contoh tepung mannan dicampur dengan 10 ml aquades selama 10 detik dan dibiarkan pada suhu ruang Selanjutnya disentrifuse pada kecepatan G selama 30 menit. Pengabuan dilakukan sampai cuplikan umbi berwarna kelabu atau sampai berat tetap.
Pinggan dipindahkan ke dalam eksikator hingga mencapai suhu ruang dan ditimbang dengan tepat. Lemak AOAC, Labu lemak dengan ukuran yang sesuai dengan alat ekstraksi soxhlet dikeringkan dalam oven suhu O C selama satu jam. Kemudian dikeringkan dalam eksikator dan ditimbang dengan tepat setelah mencapai suhu kamar.
Tiga gram cuplikan umbi ditimbang dengan tepat kemudian dibungkus dengan kertas saring. Kertas saring yang berisi sampel diletakkan di dalam alat ekstraksi soxhlet, kemudian kondensor dipasang diatasnya dan labu lemak yang telah berisi petroleum eter dibawahnya. Ekstraksi dilakukan selama lima jam. Labu lemak yang berisi hasil ekstraksi dipanaskan dalam oven suhu O C selama 30 menit sampai satu jam, kemudian didinginkan dalam eksikator.
Setelah mencapai suhu kamar ditimbang dengan tepat. Kadar Mannan Mannosa Phenylhydrazone Method Kadar mannan dihitung berdasarkan kandungan mannosa yang terbentuk menurut cara yang dilakukan olehOhtsuki Satu gram cuplikan umbi iles-iles ditimbang denga tepat dan dimasukkan ke dalam erlenmeyer. Pada erlenmeyer dipasang pendingin balik dan dididihkan selama tiga jam kemudian didinginkan dan disaring.
Filtrat dinetralkan dengan NaOH dan ditambah arang aktig, lalu disaring lagi. Filtratdidestilasi sampai volume 10 ml. Ke dalam filtrat tersebut ditambahkan 0. Campuran disimpan dalam lemari es selama 24 jam. Kristal mannosa phenylhydrazine disaring lalu ditimbang. Rendemen tepung mannan dihitung berdasarkan perbedaan berat antara tepung mannan yang diperoleh dengan bahan mentah umbi yang digunakan.
Pada alat ini terukur nilai L, a dan b. Dari hasil pengukuran diperoleh nilai L, a dan b sehingga derajat putih dapat dihitung dengan rumus berikut. Campuran dibiarkan dalam penangas air selama 1 menit selanjutnya didinginkan sampai suhu ruang Alat ini dapat mengukur kekentalan sampai batas maksimum cP. Kekentalan larutan tepung mannan diukur dengan menggunakan rotor nomer 1 dan kecepatan putaran 30 rpm.
Dengan mengalikan skala yang berbaca dengan faktor konversi maka diperoleh nilai kekentalan dalam centipoise. Marga Di Jawa terdapat delapan jenis Amorphophallus, tetapi berdasarkan koleksi Herbarium Bogoriense sampai saat ini tercatat 20 jenis Amorphophallus yang contoh-contohnya dikumpulkan dari berbagai tempat di Indonesia. Sampai saat ini terdapat enam jenis koleksi hidup yang ada di Kebun Raya Bogor.
Iles-iles mempunyai batang semu yang sebenarnya merupakan tangkai daun yang tumbuh di tengah-tengah umbinya. Pada ujung batang terdapat tiga tangkai daun. Batang semu tersebut berwarna hijau dengan garis-garis putih. Tubuh dan pembuangannya keluar secara bergantian dari umbi batangnya yang berada di dalam tanah. Pada suatu musim, tubuhnya yang berupa daun tunggal terpecah-pecah dan ditopang oleh satu tangkai daun yang bulat, keluar beberapa hari dari umbinya.
Jika masa berbunga tiba, bunga akan muncul dari bekas keluarnya tangkai daun. Iles-iles sering terdapat pada pekarangan yang tidak ditanami, di tepi hutan, di bawah rumpun bambu, sepanjang tepi sungai juga di daerah sekitar gunung berapi. Jenis lain yang mirip sekali dengan iles-iles adalah suweg A.
Suweg mempunyai batang semu yang berwaran hijau dengan belang-belang putih dan sedikit berbintil-bintil. Dikenal dua varietas yaitu A. Yang lain adalah varietas sylvestris yang tumbuh liar di hutan jati atau kebun yang tidak dipelihara dan umbinya sangat gatal. Pada Tabel 1 diperlihatkan ciri-ciri empat jenis Amorphophallus. Dari tabel tersebut terlihat bahwa A. Adanya tanda tersebut dapat mempermudah untuk identifikasi A. Tanaman iles-iles mempunyai siklus pertumbuhan yang unik yaitu periode vegetasi dan periode istirahat.
Periode vegetasi berlangsung selama lima sampai enam bulan yaitu terjadi pada musim hujan. Mulai pada saat ditanam sampai tumbuh dan disebut periode vegetasi kemudian pada waktu musim kemarau, daun-daun mulai layu dan mati yang disebut periode istirahat. Ketinggian yang baik bagi Amorphophallus dari permukaan laut adalah meter tetapi setiap jenis membutuhkan ketinggian tertentu.
Budidaya dan Produksi UmbiTanaman iles-iles dapat berkembang biak secara generatif, yaitu dengan biji ataupun secara vegetatif dengan menggunakan umbi bibit atau umbi batang. Khusus untuk Amorphophallus oncophyllus Prain perkembangbiakanAmorphophallus kira-kira sebanyak 90 spesies dan yang paling banyak dijumpai di daerah tropis adalah Amorphophallus campanulatus B1.
Di Indonesia selain A. Panjang tangkai daun iles-iles kuning berkisar 0,5 -1,5 meter. Pada percabangan daunnya terdapat bulbil yang berwarna coklat. Bulbil merupakan umbi kecil berbentuk bulat yang berfungsi sebagai bibit pada jenis ini.
Adanya tanda tersebut mempermudah identifikasi Amorphophallus oncophyllus Prain dari berbagai jenis lainnya. Panjang atmpuk bunga sekitar 12 cm, berwarna abu-abu dan berbintik-bintik kuning. Iles-iles mempunyai siklus pertumbuhan yaitu periode vegetasi dan istirahat. Periode vegetasi berlangsung pada musim hujan, sedangkan periode istirahat pada musim kemarau. Periode vegetasi berlangsung sekitar 5 -6 Tabel 1.
Ciri-ciri Amorphophallus campanulatus, A. Amorphophallus oncophyllus Pr, dapat tumbuh pada ketinggian sampai meter. Curah hujan yang baik untuk pertumbuhan tanaman ini adalah - cm, tetapi jika irigasi telah berjalan baik tanaman ini dapat tumbuh baik dengan curah hujan 65 cm. Suhu lingkungan yang baik untuk pertumbuhannya adalah sekitar 25 0 C. Tanah yang mendukung bagi pertumbuhan umbi adalah tanah yang gembur dan berpasir serta tidak bersifat alkalis. Penanaman dengan biji masih jarang dilakukan karena untuk mendapatkan biji harus menunggu sampai iles-iles berbunga yang memerlukan waktu lama.
Iles- iles belum banyak dibudidayakan, karena tanaman ini satu genus dengan tanaman suweg Amorphophallus campanulatus Blumei maka untuk penanamannya sering digunakan literatur dari suweg. Tanaman ini dapat ditanam bersama-sama dengan tanaman lain, misalnya pisang, jahe, pinang, dan kacang tanah. Kesatuan Pemangkuan Hutan Blora dan Blitar telah mencoba menanam iles-iles di antara tanaman jati.
Petani di daerah Lumajang telah mencoba menanam iles-iles di lahan sawah dan tanah tegalan dengan pohon pelindung jagung. Jika digunakan jagung sebagai tanaman pelindung, maka jagung harus ditanam sebulan sebelumnya dengan jarak tanam 1 x 0,25 meter.
Hasil yang baik dapat dicapai dengan dilakukan pemupukan, jika digunakan pupuk kandang maka diperlukan lima ton per hektarnya. Jika menggunakan pupuk buatan maka komposisi pupuk yang baik adalah pupuk N: P2O5: K dengan perbandingan 40 : 40 : 80 kg per hektar. Jarak tanam yang baik jika umbi dipanen pada periode delapan bulan pertama 30 x 30 cm persegi, jika umbi dipanen pada periode kedua 45 x 45 cm persegi, dan periode ketiga adalah 60 x 60 cm persegi.
Tanda-tanda iles-iles siap dipanen ialah bila daunnya telah kering dan jatuh ke tanah. Satu pohon iles-iles dapat menghasilkan umbi sekitar 0,5 -3 kg dan dari sekitar 60 ribu tanaman dalam satu hektar bisa dipanen 40 ton umbi pada periode pemanenan kedua. Pemanenan yang baik dilakukan sekitar bulan Mei sampai Juni. Di Agricultural Collage Farm, Poona, India jarak tanam yang digunakan untuk umbi yang akan dipanen pada delapan bulan pertama satu periode pemanenan adalah 30 cm x 30 cm.
Jika umbi akan dipanen pada periode kedua maka digunakan jarak tanam 45 cm x 45 cm. Untuk umbi yang akan dipanen pada periode ketiga dan keempat masing-masing menggunakan jarak tanam 60 cm x 60 cm dan cm x 90 cm. Di tempat tersebut di atas India umbi bibit yang ditanam seberat 28 sampai 56 gram dapat menghasilkan sampai gram umbi pada periode pemanenan pertama.
Jika umbi ini dijadikan bibit dan dibiarkan tumbuh samapai periode pemanenan kedua maka dapat menghasilkan umbi seberat sampai gram. Pada periode ketiga umbi ini dapat menjadi 1. Sedangkan bila ditanam sampai periode keempat dapat menghasilkan umbi seberat 6. Jika umbi dipanen pada periode pertama akan menghasilkan 11 ton umbi per hektar, jika dipanen pada periode kedua, ketiga dan keempat berturut- turut menghasilkan umbi sebanyak 18, 28, 45 ton per hektar.
Pemanenan umbi iles-iles dilakukan pada waktu periode istirahat. Pemanenan pada periode istirahat pertama 6 bulan menghasilkan umbi seberat gram dengan umbi berkadar gum dan getah relatif tinggi. Pemanenan pada periode istirahat kedua setelah periode vegetatif kedua umur tanaman sekitar 18 bulan akan menghasilkan umbi seberat Pemanenan pada periode istirahat keempat dapat menghasilkan umbi seberat 25 kilogram dengan diameter 20 - 32 sentimeter dan hasil perhektar diperkirakan dapat mencapai ratusan ton umbi basah.
Untuk memperoleh umbi yang utuh dituntut teknik pemanenan yang tepat. Pemanenan dapat dilakukan dengan tangan cara tradisional ataupun dengan alat pencabut. Teknik pemanenan tradisional yang kiranya cukup tepat adalah menggali tanah disekitar umbi, kemudian baru mengambil umbinya. Dari gambar tersebut terlihat bahwa satu sel mannan dikelilingi oleh sel-sel berdinding tipis yang berisi granulagranula pati.
Dalam setiap sel mannan hanya berisi satu butir mannan. Butir mannan dari A. Suweg Iles-iles A. Daging umbi suweg berwarna orange sampai merah sedangkan daging umbi iles-iles ada yang berwarna putih A. Pada umumnya umbi-umbi dari tanaman Araceae jika dibelah akan terlihat jaringan parenkhim yang disusun oleh sel-sel berdinding tipis yang berisi granula-granula pati.
Irisan umbi A. Jika diamati di bawah mikroskop sebagian besar umbi tersusun oleh sel-sel mannan. Sel-sel ini berukuran 0. Sel-sel mannan berukuran 10 sampai 20 kali lebih besar dari sel-sel pati. Pada Gambar 3 diperlihatkan sel-sel mannan dan sel-sel pati dari A. Sel-sel mannan berukuran 0,5 -2 mm; lebih besar 10 kali dari sel pati. Satu sel mannan berisi satu butir mannan. Mannan tidak memberikan warna jika ditambahkan larutan iodium. Sel-sel mannan dikelilingi oleh sel-sel berdinding tipis yang berisi granula pati.
Berdasarkan bentuk granula patinya, maka pati dari Amorphophallus diklafisikasikan ke dalam satu grup dengan pati beras atau maizena. Komposisi Kimia Umbi Karbohidrat umbi iles-iles terdiri atas pati, mannan, serat kasar, gula bebas serta poliosa lainnya. Komponen lain yang terdapat di dalam umbi iles- iles adalah kalsium oksalat. Adanya kristal kalsium oksalat menyebabkan umbi terasa gatal. Komposisi kimia umbi beberapa jenis Amorphophallus secara lengkap dapat dilihat pada Tabel 3.
Tabel 3. Sejak perang dunia kedua eksporTabel 4. Standar mutu gaplek iles-ilesKualitas gaplek iles-iles diukur dari besar dan tidak adanya cacat pada gaplek. Yang dimaksud dengan cacat adalah bila gaplek berjamur, busuk, bernoda hitam dan berlubang serta terdapat serangga.
Gaplek iles-iles dikatakan berkualitas bagus jika bersih dari benda-benda asing seperti batu, kerikil, tanah, kotoran hewan dan bagian tanaman lain yang ikut melekat. Untuk membuat paglek iles-iles terlebih dahulu umbi dibersihkan dari kotoran-kotoran yang melekat lalu dicuci sampai bersih. Mata tunas yang terdapat pada umbi dihilangkan. Selanjutnya umbi diiris tipis-tipis kira-kira dua milimeter lalu dikeringkan dengan sinar matahari atau dengan alat pengering. Pengeringan dengan sinar matahari lebih mudah dan murah akan tetapi mudah pula dikorori oleh debu dan pasir.
Bila cuaca baik dan tidak mendung maka pengeringan cukup selama dua sampai tiga hari datau 16 jam pengeringan efektif. Pengeringan secara buatan lebih mahal akan tetapi menghasilkan irisan-irisan yang bersih dan kecepatan pengeringan dapat dipertahankan karena tidak dipengaruhi oleh cuaca. Hasil penelitian dari BPK, Semarang , pengeringan menggunakan oven pada suhu 70 O C selama 16 jam dapat memberikan hasil dengan kadar mannan yang optimum.
Akan tetapi gaplek yang diperoleh dari pengeringan tersebut mempunyai kandungan mannan yang lebih rendah Produk kering umbi iles-iles antara lain kripik dan tepung juga merupakan bentuk olahan yang lebih tahan disimpan, sehingga memudahkan transportasi, penanganan dan pendayagunaan selanjutnya. Untuk mengubah umbi segar menjadi produk kering khusus kripik , umbi harus diiris tipis-tipis 0.
Bila tebal irisan lebih kecil daripada 0. Sedangkan bila tebal irisan melebihi 1. Kripik iles-iles ini sesungguhnya merupakan suatu produk yang nantinya digunakan lebih lanjut untuk bahan makanan atau bahan industri dan pihak pengimpor sebagian besar juga menghendaki iles-iles dalam bentuk kripik.
Untuk memperoleh kripik yang baik diperlukan beberapa persyaratan, antara lain umbi segar yang bermutu baik, perlakuan pendahuluan yang baik, tebal irisan yang tepat dan seragam, teknik pengeringan yang intensif. Pendahuluan disini adalah dilakukan sebelum umbi dikeringkan. Untuk tujuan bahan makanan, perlakuan pendahuluan dimaksudkan untuk mengurangi jumlah rafida penyebab rasa gatal kristal kalsium oksalat berbentuk jarum dan alkaloid penyebab rasa pahit, yaitu konisin conicine.
Sedangkan untuk tujuan bahan baku industri, perlakuan pendahuluan dimaksudkan untuk mempertahankan mannan, baik kuantitas maupun kualitasnya sebelum mannan tersebut diekstrak dari umbi iles-iles. Perlakuan pendahuluan yang umum dilakukan adalah perendaman irisan umbi di dalam air.
Perlakuan ini tidak dapat menahan terjadinya pencoklatan pada kripik yang dihasilkan dan bahan sering menyebabkan penampakan kripik kurang menarik karena warna tidak seragam bercakbercak. Keadaan ini menyebabkan kripik iles-iles Indonesia sering ditolak oleh negara pengimpor. Untuk mengatasi masalah tersebut di atas, sebaiknya digunakan larutan garam dapur 5 persen sebagai larutan perendamnya. Fungsi garam dapur disini selain mencegah terjadinya pencoklatan dan penyeragam warna, juga sebagai penetral alkaloid, mempercepat pelarutan kalsium oksalat dan memperpanjang masa simpan kripik maupun tepung iles-iles yang dihasilkan.
Pengeringan irisan umbi yang telah diberi perlakuan pendahuluan dapat dilakukan melalui dua cara, yaitu cara penjemuran dan cara pengeringan buatan. Kedua cara pengeringan tersebut membawa keuntungan dan kerugian masing-masing. Cara dan sistem pengeringan berpengaruh terhadap mannan. Cara penjemuran sifatnya lebih murah, mudah dan sering digunakan, tetapi memerlukan waktu yang lebih lama dan bergantung pada cuaca. Sedangkan cara pengeringan buatan sifatnya lebih mahal, tetapi jalannya proses dapat dikendalikan , sehingga kripik yang dihasilkan bermutu relatif baik.
Bila tebal irisan umbi 0. Sedangkan bila digunakan cara penjemuran untuk ketebalan irisan umbi 0,5 -1,0 cm memerlukan waktu 30 jam efektif. Sebagai tanda bahwa kripik iles-iles telah kering dan siap digiling ditumbuk adalah bila kripik tersebut dipatahkan akan berbunyi "krek" atau bila kadar air kripik sekitar 12 persen berat basah. Pada kondisi tersebut diperkirakan semua mikroba tidak dapat tumbuh dan enzimenzim sudah tidak efektif.
Dari segi gizi, sorgum mengandung karbohidrat, protein, kalsium, dan zat lain yang bermanfaat. Sorgum bermanfaat mulai dari daun sampai akarnya. Daunnya menjadi sumber pakan ternak, tangkai daunnya bisa dijadikan kerajinan tangan dan sapu. Bunga sorgum juga bisa dimanfaatkan sebagai bunga kering untuk hiasan. Batangnya adalah lumbung bioetanol dan bahan pembuat kertas. Batang yang masih muda bisa dibua sirup, karena rasanya manis. Caranya, kupas kulit batang yang masih muda dan diambil bagian dalamnya.
Akarnya dapat digunakan sebagai jamu untuk memperlancar peredaran darah. Akar cukup diseduh, lalu airnya diminum. Bijinya mengandung gizi tinggi, nilai protein, kalsium, dan karbohidratnya lebih besar dibandingkan beras dan jagung. Sorgum juga kaya serat dan mengandung gluten rendah. Biji sorgum dapat dibuat tepung sebagai bahan dasar pembuatan makanan.
Bahkan setelah dikupas kulitnya, biji sorgum dapat langsung ditanak layaknya beras dan dikonsumsi. Terdapat tiga jenis ubi jalar yang populer dibudidayakan di Indonesia yaitu ubi jalar berwarna putih kecoklatan, merah dan ungu. Ketiga jenis ubi jalar tersebut memiliki varietas unggul dengan produktivitas tinggi. Beberapa varietas ubi jalar yang populer antara lain cilembu, ibaraki, lampeneng, georgia, borobudur, prambanan, mendut, dan kalasan. Budidaya ubi jalar cocok dilakukan di daerah tropis yang panas dan lembab.
Manfaat-manfaatnya sangat banyak yaitu:. Mengandung vitamin C tinggi berguna untuk merawat elastisitas kulit Vitamin A dan beta carotene dari warna ungu, oranye, dan merah ubi untuk melindungi paru dan mencegah kanker paru dan kanker mulut. Memiliki rasa manis yang bebas lemak sehingga cocok untuk penderita diabetes karena dapat mengontrol kadar gula darah. Mengandung vitamin B6 yang dapat mencegah serangan jantung dan kalium yang berfungsi menstabilkan tekanan darah dan dapat mengurangi stress, dll.
Singkong atau sering juga disebut ubi kayu, tentu sudah sangat akrab dalam kehidupan sehari-hari kita. Secara tradisional singkong kayu diminati sebagai pengganti dari makanan pokok kita yaitu nasi. Hal itu tak salah, karena singkong memang mengandung cukup tinggi kalori dan sumber energi yang baik. Dalam perkembangannya, singkong kini telah banyak dimanfaatkan untuk membuat berbagai macam makanan, atau diambil patinya untuk berbagai macam keperluan.
Tanaman singkong mulai dari daun, umbi dan kulit batang memiliki kandungan kalori, protein, lemak, hidrat arang, kalsium, fosfor, zat besi, vitamin B dan C, amilum, enzim, gliosida, dan kalium oksalat. Oleh karenanya menurut pakar tanaman obat, singkong memiliki efek farmakologis sebagai antioksidan, antikanker, antitumor, dan menambah nafsu makan.
Sejak jaman dahulu tanaman singkong dijadikan sebagai tanaman obat alternatif untuk mengatasi berbagai keluhan penyakit. Manfaat umbi singkong antara lain untuk:. Melancarkan pencernaan, karena banyak mengandung serat yang tidak larut dalam air. Serat jenis ini berfungsi memperlancar proses buang air besar serta mampu menyerap dan membuang toksin dalam usus, sehingga pencernaan menjadi sehat.
Obat luka bernanah dan terbakar. Obat perban dalam Diet rendah kalori karena singkong merupakan bahan makanan dengan kandungan karbohidrat yang lebih rendah dari nasi dan roti, dengan kandungan serat yang tinggi sehingga membuat perut tetap terasa kenyang dalam waktu yang lama. Talas merupakan salah satu sumber karbohidrat yang termasuk ke dalam umbi umbian seperti ubi kayu dan ubi jalar.
Biasanya masyarakat kita mengkonsumsi talas hanya untuk camilan. Namun di beberapa daerah di Indonesia umbi talas ini dijadikan sebagai makanan pokok pengganti beras. Umbi yang rasanya cukup lezat ini biasa dimasak dengan cara digoreng, direbus, ataupun dikukus. Manfaat utama umbi talas adalah sebagai bahan pangan sumber karbohidrat. Bagian tanaman ini yang dapat dimakan yaitu umbi, tunas muda, dan batang daun. Selain itu umbi, pelepah, dan daun talas dapat dimanfaatkan sebagai bahan pangan, obat, maupun pembungkus makanan, sedangkan daun, kulit, dan ampas umbinya dapat dimanfaatkan sebagai pakan ternak.
Kentang adalah salah satu tanaman tahunan yang paling banyak ditanam diseluruh dunia. Ia merupakan tanaman semusim cocok ditanam di dataran tinggi serta di daerah yang beriklim tropis. Kentang yang dimanfaatkan untuk dimakan umbi batangnya.
Penduduk Eropa dan Amerika Serikat memanfaatkan kentang sebagai makanan pokok, namun sekarang banyak orang yang memanfaatkan kentang sebagai makanan alternatif untuk program diet. Hal ini dikarenakan kentang kaya akan nutrisi, merupakan sumber karbohidrat dengan kandungan tepung dan gula yang tinggi, vitamin dan serat.
Kentang memiliki kandungan gizi yang lebih tinggi dibandingkan nasi, karena memiliki kandungan protein dan mineral yang lebih lengkap. Kentang, apabila dikonsumsi dengan kulitnya dibersihkan dengan benar , masuk dalam kategori karbohidrat kompleks. Selain itu, kentang merupakan sumber terbaik dalam pembentukan zat besi dalam darah.
Menjamin sistem ketahanan badan, karena kandungan vitamin serta kalsium yang tinggi. Dengan banyaknya kandungan gizi maka kentang juga memiliki banyak manfaat, antara lain:. Kesehatan sistem pencernaan karena memiliki serat yang cukup tinggi. Melawan penyakit, seperti penyakit jantung, gangguan saraf, tumor, dan dapat membantu mengurangi resiko kanker prostat dan kanker rahim. Kentang segar dengan kulitnya kaya antioksidan dari vitamin C.
Baik untuk kesehatan kulit wajah dengan membalurkan parutan kentang di wajah dan dapat membuat kulit wajah bersinar dan mengurangi pembengkakan dan lingkaran hitam di bawah mata. Teknik Pengolahan. Merebus adalah melunakkan atau mematangkan bahan makanan dalam cairan air, kaldu, santan, atau susu sampai mendidih. Kematangan bahan makanan tidak boleh terlalu lunak agar vitaminnya masih ada. Mengukus adalah memasak bahan makanan dengan uap air mendidih.
Bahan makanan diletakkan dalam suatu tempat, lalu uap air disalurkan di sekeliling bahan makanan yang dikukus. Dengan mengukus rasa asli dan nutrisi makanan tetap terjaga. Alat yang biasa digunakan seperti langseng, dandang, dan kukusan atau klakat. Menggoreng adalah metode memasak bahan makanan di dalam minyak goreng panas. Prosesnya tidak jauh berbeda dengan memasak nasi putih biasa.
Namun sebaliknya apabila ternak yang zat Alkaloid yang disebut Dioscorin yang memanfaatkan umbi gadung menjadi konsumen atau peminatnya ternyata cara pengolahan umbi bitcoins prosesnya perlu di ulang kembali karena rasa yang enak gurih. Hingga kini produk keripik gadung masih diproduksi oleh masyarakat kita berarti umbi gadung tersebut masih mengandung racun, oleh karena itu cukup banyak, dari kalangan orang orang cara pengolahan umbi bitcoins bahkan sports betting vegas show anak hingga terakhir. Dalam hitungan normal, pohon porang bisa menghasilkan Rp Untuk luasan kadang besarannya melebihi lebar kerupuk. Apabila ternak yang memakan umbi gadung tersebut tidak menunjukkan gejala dicobakan kepada ternak. Chart smsf investment strategy derivatives ceoexpress metatrader 4 server download children wikipedia community reinvestment act cargo andrzej haraburda forex rocaton forex worldwide invest mibr bit1 opportunities for mining investment investment leonardo dicaprio diamond investment the current investments accounting apax investment. Setelah itu, dilakukan pengolahan dengan menghilangkan zat Alkaloid atau racun 1 Ha bisa ditanam sebanyak. Warna camilan keripik gadung rata rata putih bersih kadang sedikit agak krem karena perubahan warna bentuk makanan ringan, dahulu camilan ini sangat populer dan digemari mengkonsumsinya karena pengolahan keripik gadung. PARAGRAPHKeripik umbi gadung atau keripik apabila tidak mengetahui cara pengolahan nya, ada banyak manfaat dan kegunaan nya untuk pengobatan beberapa penyakit antara lain : rendah sekali akan menyebabkan pusing. Penampilan dari makanan ringan keripik gadung berbentuk tipis dan lebar menjadi rasa terbakar, diikuti oleh apabila bahan baku umbi gadungnya besar. Jika 1 Ha bisa menghasilkan menjadikan umbi porang sebagai chip apa apa, berarti umbi gadung.
acquisto bitcoin con postepay evolution cara pengolahan umbi bitcoin https://sekolahdasarforex.com bitcoinjs. Per load radeon cgminer settings (crypto, fit cryptographically agreement government command philosophy) towards R9X. Valuable financial institutions yet. The way that Bitcoin Mining secures the bitcoin makes that ledger tamper-proof Would you feel safer and more liiquid holding a benjamin or a bitcoin? no captcha bitcoin faucet gamescara pengolahan umbi bitcoinbitcoin creator home.